KEGG   Sphingomonas sanxanigenens: NX02_15635
Entry
NX02_15635        CDS       T03929                                 

Definition
(GenBank) hypothetical protein
  KO
K22086  methylglutamate dehydrogenase subunit C [EC:1.5.99.5]
Organism
ssan  Sphingomonas sanxanigenens
Pathway
ssan00680  Methane metabolism
ssan01100  Metabolic pathways
ssan01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ssan00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    NX02_15635
Enzymes [BR:ssan01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.99  With unknown physiological acceptors
    1.5.99.5  methylglutamate dehydrogenase
     NX02_15635
SSDB
Motif
Pfam: GCV_T SO_alpha_A3 Fer2_4 GCV_T_C Pyr_redox_2 FAD_oxidored FAD_binding_2 HI0933_like NAD_binding_8 GIDA Pyr_redox_3 FAD_binding_3 Thi4 AlaDh_PNT_C Lycopene_cycl
Other DBs
NCBI-ProteinID: AHE54807
UniProt: W0AE30
LinkDB
Position
3253205..3256183
AA seq 992 aa
MTMTGNVHRLETGGLVDRSAPLSFRFDGKAMTGFEGDTLASALVANGVRLVGRSFKYHRP
RGILTAGSEEPNALVTLRGGAHAEPNSRATTISLFDGLEATSQNRWPNLSFDLLAVNQLA
APLFVAGFYYKTFMWPAAFWEKLYEPLIRRAAGLGALSGLPDPDHYDRGHGFCDLLVIGG
GPAGLAAALTAGRAGLRVIVADEDARTGGRLLAERHEVDGLPGALWAEQATAELAALPNV
RILLRTTVFGVFDGGEYGAVERVSDHLAAPLPGQPRQRLWKIVARRAILASGAIERPIIF
GGNDRPGVMMASAAATYVNRFAAAPGRRGIIFTTSDSGWTAAADLIAAGVELAAIVDARP
GPIAMPDAVRRAGVPVFAGAVVEDVTGRTMRGAAIRDAEGRQHRIKADFLGMAGGWNPSI
GIGTNMGARPVWAPEIDSFLLDKAPPGMRAAGAAAGHFGLPEALRDGAETAAAIVEDSGR
SRPALPPLTTSADPAGARPCWHVATRRTKAFVDFQHDVTDSDIGLAAREGFVSIEHLKRY
TTLGMATDQGKTSQLNGHALLAAATGKSIAEAGTIASRPPYLPVAIGVLAGHHRGTDFRP
ERRTPSHDWAAGQGATFVDVGLWKRAQWYARAGETDWLQSVDREVSATRGGVGICDVSTL
GKIDVMGPDAAVLLDRLYINMMSTLKVGRARYGVMLRDDGIVFDDGTATRFAPDHFFVTT
TTVNAARVMQHIDHARQVLWPELDVQATSVTENWGTYSVAGPRARALLQAAFPDLPLDDA
ALPYMGAAKFRWNGVPARIYRLSFSGELAYEVSVPARHADALLRHLFAVGAAFDLTPYGT
EALGVMRIEKGHVAGNELNGQTTAGDLGLGRMMSTKKDYIGRIMAQRPGLVAPDRPTLVG
LKPVDRAKRLRAGAHLLPTTATGRTAADDQGFVTSVCHSPTLGHWIGLALLVHGPERHGE
RIIIHDPVRDGDLEAEICPPVFVDPEGARLHG
NT seq 2979 nt   +upstreamnt  +downstreamnt
atgaccatgaccggcaacgttcaccgcctcgaaaccggcggcctcgtcgatcgctcggcg
cccctctccttccgcttcgacggcaaggcgatgaccggcttcgagggcgatacgctcgcc
tccgcgctggtcgccaacggcgtccgccttgtcggccgttcgttcaaatatcaccggcca
cgcggcatcctgacggcgggcagcgaggaacccaacgcgctcgtcacattgcgcgggggc
gcccatgccgaacccaacagccgcgcgaccacgatcagcctgttcgacgggctggaggcg
accagccagaaccgctggccgaacctgtcgttcgacctgctggcggtgaaccagctggcg
gcgccgctgttcgtcgccggcttctactacaagaccttcatgtggccggcggcattctgg
gaaaagctctacgagccgctgatccgccgcgcggcggggctcggcgcgctttccggcctg
cccgatcccgaccattatgatcgcggccatggcttctgcgacctgctcgtcatcggcggc
ggacccgctggcctcgccgcggcgctgaccgccgggcgtgccgggctgcgcgtaatcgtg
gcggacgaggatgcgcggaccggcggcaggctgcttgccgagcgccacgaggtggatggc
ctgcccggcgcgctttgggctgaacaggcgactgccgaactcgccgcgctgcccaacgtt
cgcatcctgctgcgcaccaccgtgttcggcgtgttcgacggcggtgaatatggcgctgtc
gagcgcgtgtccgaccatcttgcggcgccgctgcccggccagccccgccagcggctgtgg
aagatcgtcgccaggcgcgcgatcctcgccagcggcgcgatcgaacggccgatcatcttc
ggcggcaacgaccgccccggcgtgatgatggcctcggccgccgcgacctatgtcaaccgc
ttcgccgccgcgcccggcaggcgcggcatcatcttcaccaccagcgacagcggctggacc
gccgccgccgacctgatcgccgcgggcgtcgagcttgccgcgatcgtcgatgcgcgcccc
ggcccgatcgcgatgcccgatgcggtgcgcagggctggcgtgcccgtcttcgccggcgcg
gtcgtcgaggatgtcactggccggacgatgcgcggcgctgcgatccgcgacgccgagggt
cggcagcatcgcatcaaggccgacttcctcggcatggcgggcggctggaacccatcgatc
ggcatcggcaccaacatgggcgccaggcccgtctgggcgcccgagatcgacagcttcctg
ctcgacaaggcgccgccggggatgcgcgccgcgggcgcggctgcgggccatttcggcctg
cccgaagcattgcgcgacggcgccgagacggccgctgcgatcgtcgaggatagcgggcgc
tcgcgtcccgcgctgccgccgctcaccaccagcgccgatccggcgggcgcgcggccctgc
tggcacgtcgcgacgcgccgcaccaaggcgttcgtcgacttccagcacgacgtcaccgac
agcgacatcgggctggcggcgcgcgagggcttcgtctcgatcgagcatctcaagcgctac
accacgctcggcatggcgaccgaccagggcaagaccagccagttgaacggccacgcgctg
ctcgccgccgccaccggcaagtcgatcgccgaggccggcaccatcgcctcgcgcccgccc
tatctgccggtcgcgatcggcgtgctcgccggccatcaccgcggcaccgacttccgcccc
gaacgccgtacgccctcgcacgactgggcggccggccagggcgcgaccttcgtcgacgtc
ggcctgtggaagcgcgcgcaatggtatgcacgcgccggcgagaccgactggctgcagagc
gtcgaccgcgaggtcagcgcgacgcggggcggcgtcggcatctgcgacgtctcgacattg
ggcaagatcgacgtgatgggcccggatgcggcggtgctgctcgaccggctctacatcaac
atgatgtcgacattgaaggtggggcgcgcccgctatggcgtgatgctgcgcgacgacggc
atcgtcttcgacgacggcaccgcgacccgcttcgcccccgaccatttcttcgtcaccacc
accaccgtcaatgcggcgcgtgtgatgcagcatatcgaccatgcccggcaggtgctgtgg
ccggagcttgacgtgcaggcgacttcggtcaccgaaaattggggcacctattcggtcgct
ggcccgcgcgcgcgcgcgctgctgcaggccgccttccccgatctgccgcttgacgatgcg
gcgctgccctatatgggcgccgcgaagttccgctggaacggcgtaccggcacggatctac
cgcctctccttctcgggcgagctcgcctatgaggtcagcgtgcccgcgcgccacgccgat
gcgctgctgcgccatctgttcgcggtcggtgcagcgttcgacctcaccccctatggcacc
gaggcgctgggcgtgatgcgcatcgagaagggccatgtcgcgggcaacgagctcaacggc
cagaccaccgccggcgacctcggcctcggccggatgatgtcgaccaagaaggattatatc
ggccgcatcatggcgcaacggcccgggctggtcgcacccgaccggccgacattggtcggg
ctcaagcccgtagaccgcgcgaagcggctgcgcgccggcgcgcatctgctgccgaccact
gccaccggccgcaccgccgcagacgatcagggcttcgtcacctcggtctgccattcgccg
acgctcggccactggatcggcctcgccctgctcgtgcacggccccgagcgccatggcgag
cgcatcatcatccacgatccggtgcgcgacggcgatctcgaggccgagatctgcccgccg
gtcttcgtcgatccggaaggagcacggctgcatggctga

DBGET integrated database retrieval system