KEGG   Sphingomonas sanxanigenens: NX02_16440Help
Entry
NX02_16440        CDS       T03929                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
ssan  Sphingomonas sanxanigenens
Pathway
ssan00680  Methane metabolism
ssan01100  Metabolic pathways
ssan01120  Microbial metabolism in diverse environments
ssan01200  Carbon metabolism
Module
ssan_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:ssan00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    NX02_16440
  09102 Energy metabolism
   00680 Methane metabolism
    NX02_16440
Enzymes [BR:ssan01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     NX02_16440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase
Motif
Other DBs
NCBI-ProteinID: AHE54967
UniProt: W0AEL6
LinkDB All DBs
Position
3425284..3427974
Genome map
AA seq 896 aa AA seqDB search
MQHQGMAAAPPITQNPDIRYLGRLLGDVIRSYGGETLFRRTEYIRSASVDRHRGVAGADA
IDTGLDALSLDDTIAFVRGFMLFSMLANLAEDRQGVATDPGADVAHALERLKDEGVDARA
VAAMLEKALVAPVLTAHPTEVRRKSMIDHRNRIAELMLLKDMGHAETREGDKVDEAILRQ
IALLWQTRPLRRERLYVADEVENALAYFRDAFLPALPALYARWDRALGQRVPSFLRPGSW
IGGDRDGNPNVTAASLQLALARAAETVIGHYLEQLHALGAELSISTELASVSDAVVALAE
KSGDDSAARRDEPYRRAISGIYARLAATYSEISGRAAPRAITIKAEAYPDPQSFRADLVA
IALDLAQTGGGALKSGGALGRLIRAVETFGFHLATLDMRQNSSVHERVVAELLKVAGVEA
DYLALDEAARVALLRRELANARPLTSPFAGYSDETRGELDIVHAAAAAHRRYGPACITNY
IVSMAQSVSDLLEVNILLKEAGLYRPGDTPTAAIMAVPLFETIGDLDKAPGIMSDWLSLP
EIAGISALRGHQEVMIGYSDSNKDGGYLTSTWGLHQASRALVPVFEQHGVAMQLFHGRGG
SVGRGGGSSFQAIRAQPHGTVAGRIRITEQGEVIAAKYGNVESAMTNLEAMASATLLASL
EPDPIGEADRTRFAACMDQLSDDAFRAYRGLVYETDGFRQFFRQMTPLTEIADLKIGSRP
ASRKKSDAIEDLRAIPWVFSWAQARVMLPGWYGVGEALAAFRDQALLREMVEAWPFLQST
LANMEMVLAKSDMLIAAKYAELVEDKTAAQAIFGRIRDGWQKAHDGLLTVTRQTRLLEKN
PALDQSIRLRLPYIEPLNLLQVELLKRHRAGEDDARIREGIQLSINAVATALRNSG
NT seq 2691 nt NT seq  +upstreamnt  +downstreamnt
atgcagcatcagggcatggccgccgctccccccatcacgcagaatcccgacatccgctat
ctcgggcggctgctgggcgatgtcatccgcagctatggcggcgagacgctgttccgccgc
accgaatatatccgctcggcctcggtcgaccggcatcgcggcgtcgccggcgccgacgcg
atcgacaccgggctcgatgcgttgagcctggacgatacgatcgccttcgtgcgcggcttc
atgctgttttcgatgctcgccaacctcgccgaagaccgccagggcgtcgcgaccgacccc
ggcgcggacgttgcgcacgccctcgaacggctgaaggacgagggcgtcgatgcccgcgcc
gtcgcggcgatgctggaaaaggcgctggtcgcgcccgtgctcaccgcgcaccccaccgaa
gtgcgccgcaagtcgatgatcgaccatcgcaaccgcatcgccgaactgatgctgttgaag
gatatgggccacgccgagacgcgcgagggcgacaaggtggacgaggcgatcctgcgccag
atcgcgctgctgtggcagacgcgcccgctgcgccgcgaacggctctatgtcgccgatgag
gtggagaacgcgctcgcctatttccgcgatgccttcctccccgcccttcccgcgctctat
gcccgctgggatcgcgcgctcggccagcgcgtgcccagtttcctgcgcccgggaagctgg
atcggcggcgaccgcgacggcaaccccaacgtgactgccgcctcccttcagctcgccctc
gcccgcgccgccgagacggtgatcggccattatctcgaacagctccatgcgctgggtgcc
gaactgtcgatctccaccgagttggcgagcgtcagcgatgcggtggtggcgctggcggaa
aagagcggcgacgacagcgccgcgcggcgcgacgagccctatcgccgcgcgatcagcggc
atctatgcacgcctcgccgcgacctacagcgagatcagcgggcgcgccgcgccgcgcgcg
atcacgatcaaggccgaggcctatcccgatccgcagagcttccgcgcagacctcgtcgcc
atcgcgctcgaccttgcgcagacaggcggtggcgcgctcaagtccggcggcgcgctcggg
cggctgatccgcgcggtcgagaccttcggcttccacctcgccacgctcgacatgcgccag
aactcttcggtgcacgagcgcgtcgtcgccgaactgctcaaggtcgcgggcgtcgaagcg
gattatctggcgctcgacgaagccgcgcgggtcgcgctgctgcgccgcgaactcgccaat
gcccgcccgctgaccagccccttcgccggctatagcgacgagacgcgcggcgaactcgac
atcgtgcatgccgccgcggcggcgcatcggcgctacggccccgcctgcatcaccaattac
atcgtctcgatggcgcagagcgtgtccgacctgctcgaggtcaatatattactcaaggaa
gccggcctctaccgccccggcgacacgcccaccgccgcgatcatggcggtgccgctgttc
gagacgatcggcgacctcgacaaggcgcccggcatcatgtccgactggctctcgctgccc
gagatcgccggcatctcggcgctgcgcggccatcaggaagtgatgatcggctattcggac
agcaacaaggatggcggctacctcacctccacctggggcctccaccaggccagccgcgcg
ctggtgccggtgttcgagcagcatggtgtggcgatgcagctgttccacggccgcggcggt
tcggtcggccgcggcggcggctccagcttccaggcgatccgcgcgcagccgcacggcacc
gtcgccggccgcatccgcatcaccgaacagggcgaggtgatcgcggccaaatatggcaat
gtcgaaagcgcgatgaccaatctggaggcgatggcatcggcgacgttgctcgcctcgctg
gagcccgatccgatcggcgaggcggatcgcacgcgcttcgccgcctgcatggaccagctt
tcggacgatgcattcagggcctatcgcggcctcgtctacgagaccgacggcttccgccaa
ttcttccggcagatgacgccgctgaccgagatcgccgacctcaagatcggatcgcgcccc
gccagccgcaagaaatccgacgcgatcgaggatctgcgcgcgatcccctgggtgttcagc
tgggcgcaggcgcgcgtgatgctgccgggctggtatggcgtgggcgaggcgctggcggct
ttccgggaccaggcgctgctgcgcgagatggtggaggcatggcccttcctgcaatcgacg
ctcgccaacatggaaatggtgctcgccaagtccgacatgttgatcgccgccaaatatgcc
gagctggtcgaggacaagaccgccgcgcaggcgatcttcggccgcatccgcgacggctgg
cagaaggcgcatgacgggctgctgacggtgacccgccagacccgcctgctggaaaagaac
ccggcgctggatcaatccatccgcctgcgcctgccctatatcgagccgctcaacctgctg
caggtcgaactcctcaagcgccaccgcgccggcgaggacgatgcgcggatccgcgagggc
atccagctgtcgatcaacgcggtggcgacggcgctgcggaacagcgggtaa

DBGET integrated database retrieval system