KEGG   Sphingomonas sanxanigenens: NX02_16520
Entry
NX02_16520        CDS       T03929                                 

Definition
(GenBank) dihydrolipoamide dehydrogenase
  KO
K00382  dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
ssan  Sphingomonas sanxanigenens
Pathway
ssan00010  Glycolysis / Gluconeogenesis
ssan00020  Citrate cycle (TCA cycle)
ssan00260  Glycine, serine and threonine metabolism
ssan00280  Valine, leucine and isoleucine degradation
ssan00310  Lysine degradation
ssan00380  Tryptophan metabolism
ssan00620  Pyruvate metabolism
ssan00630  Glyoxylate and dicarboxylate metabolism
ssan00640  Propanoate metabolism
ssan01100  Metabolic pathways
ssan01110  Biosynthesis of secondary metabolites
ssan01120  Microbial metabolism in diverse environments
ssan01200  Carbon metabolism
Module
ssan_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ssan_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ssan_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ssan00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NX02_16520
   00020 Citrate cycle (TCA cycle)
    NX02_16520
   00620 Pyruvate metabolism
    NX02_16520
   00630 Glyoxylate and dicarboxylate metabolism
    NX02_16520
   00640 Propanoate metabolism
    NX02_16520
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NX02_16520
   00280 Valine, leucine and isoleucine degradation
    NX02_16520
   00310 Lysine degradation
    NX02_16520
   00380 Tryptophan metabolism
    NX02_16520
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ssan04147]
    NX02_16520
Enzymes [BR:ssan01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     NX02_16520
Exosome [BR:ssan04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   NX02_16520
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox Pyr_redox_3 GIDA FAD_oxidored FAD_binding_2 HI0933_like NAD_binding_8 AlaDh_PNT_C FAD_binding_3 K_oxygenase Thi4 3HCDH_N
Other DBs
NCBI-ProteinID: AHE54983
UniProt: W0AFE4
LinkDB
Position
complement(3444283..3445677)
AA seq 464 aa
MADYDYDVLVIGAGPGGYVAAIRAAQLGLRTACAESRETLGGTCLNVGCIPSKALLHASH
LYEEAHSGALARWGVKVEGASLDLDAMHASRKEAVTGLTGGVAFLFKKNKVDWLKGLATF
TGKDSVEVAGKTYRAKNIVIATGSSVTPLPGVEIDHQSIIDSTSALELPKVPDHLVVIGG
GVIGLELGSVWRRLGAKVTVVEYLDQILPGMDGEIRKEAAKIFRKQGIEIVTSTKVTGAT
KTDKGVTLTVEPAAGGEASTIEADVVLVSIGRRPNTEGLGLDKAGIELNKRSQIETDHSF
ATKVDGIWAIGDVIPGPMLAHKAEDEGIAVAENIAGLTGIVNHDVIPSVVYTLPEIAGVG
LTEEQAREKGEIKVGKFPMAGNSRAKTIHDTTGFVKVIADAKTDRVLGAWIITSVAGTMI
AQVAQAMEFGATSEDIAYTCHAHPTHSEAIKEAAMAVLGKPIHV
NT seq 1395 nt   +upstreamnt  +downstreamnt
atggctgactacgactatgacgtcctcgtgatcggcgctggcccgggcggctatgtcgcc
gcgatccgcgccgcgcagcttggcctgcgcacggcgtgcgcggagagccgcgagacgctg
ggcggcacctgcctcaacgtcggctgcattccctccaaggcgctgctccacgcctcgcac
ctctatgaggaagcgcattccggcgcgcttgcgcgctggggcgttaaggtcgaaggcgcc
agcctcgacctcgatgcgatgcacgcgagccgcaaggaagccgtgaccggcctcaccggc
ggcgtcgccttcctgttcaagaagaacaaggtcgactggctgaagggcctcgcgaccttc
accggcaaggacagcgtcgaggtcgccggcaagacctaccgtgccaagaacatcgtcatc
gccaccggctccagcgtcaccccgctgcccggcgtcgagatcgaccatcagtcgatcatc
gattcgaccagcgcgctcgaactgcccaaggtgcccgatcatctggtcgtcatcggcggg
ggcgtgatcgggctcgaactgggctcggtgtggcgtcgcctgggtgcgaaggtgaccgtg
gtcgaatatctcgaccagatcctgccgggcatggacggcgagatccgcaaggaagccgcc
aagatcttcaggaagcagggcatcgagatcgtcaccagcaccaaggtgacgggtgccacc
aagaccgacaagggcgtgaccctgaccgtcgagcccgccgccggcggcgaagcctcgacg
atcgaggccgatgtcgtgctggtctcgatcggccgtcgtccgaacaccgagggcctcggc
ctggacaaggcgggcatcgagctcaacaagcgcagccagatcgaaactgatcacagcttc
gcgaccaaggtcgacggcatctgggcgatcggtgacgtgatcccgggcccgatgctcgcg
cacaaggccgaggacgaaggcatcgccgtcgccgagaacatcgccggcctgaccggcatc
gtgaaccacgatgtgatcccgagcgtggtctacacgctgcccgagatcgccggcgtcggc
ctgaccgaagaacaggcgcgcgagaagggtgagatcaaggtcggcaagttcccgatggcg
ggcaacagccgcgccaagaccatccacgacaccaccggtttcgtgaaggtcatcgccgac
gccaagaccgaccgcgtgctcggcgcctggatcatcacgtcggttgccggcacgatgatc
gcgcaggtcgcccaagcgatggaattcggcgccaccagcgaggatatcgcctacacctgc
catgcccacccgacgcactcagaggcgatcaaagaagcggcgatggcggttttgggtaag
cccatccacgtctga

DBGET integrated database retrieval system