KEGG   Sphingomonas sanxanigenens: NX02_18950Help
Entry
NX02_18950        CDS       T03929                                 

Definition
(GenBank) hypothetical protein
  KO
K02554  2-keto-4-pentenoate hydratase [EC:4.2.1.80]
Organism
ssan  Sphingomonas sanxanigenens
Pathway
ssan00360  Phenylalanine metabolism
ssan00362  Benzoate degradation
ssan00621  Dioxin degradation
ssan00622  Xylene degradation
ssan01100  Metabolic pathways
ssan01120  Microbial metabolism in diverse environments
ssan01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ssan00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    NX02_18950
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    NX02_18950
   00622 Xylene degradation
    NX02_18950
   00621 Dioxin degradation
    NX02_18950
Enzymes [BR:ssan01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.80  2-oxopent-4-enoate hydratase
     NX02_18950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAA_hydrolase
Motif
Other DBs
NCBI-ProteinID: AHE55454
UniProt: W0AC07
LinkDB All DBs
Position
4006368..4007153
Genome map
AA seq 261 aa AA seqDB search
MVEIAADEQVGAVARQLADAYAGAPIAPVADRIADVAQAYRVQLAQIEERIAGGRRIVGR
KIGLTSPAVQRQLGVGEPDFGHLTDEMVHGDNAALAHADLRQPRVEAEVALILGADLDMP
NPTVADVIAATAYAVPALEVVASRIADWKIGILDTIADNASAGAVVLGGPARRLDGLDLS
GCAMALRINDTIVSEGRGADCLGNPLNAAAWLAARSHALGRPLRAGELILTGALGPMRPV
APGDAVHAEIAGLGTVSVTFR
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggttgagatcgccgcagacgaacaggtcggtgccgtggcgcggcagcttgccgatgcc
tatgccggcgcgccgatcgcgccggtggccgatcggatcgcggacgtggcgcaggcctat
cgcgtgcagctggcgcagatcgaggaacgcatcgccggcggccggcgcatcgtcggccgc
aagatcggcctcacctcccccgcggtccagcgccagcttggcgtcggcgaacccgatttc
ggccatctgaccgacgagatggtgcatggcgacaatgccgcgctcgcccatgccgatctg
cgccagccgcgcgtcgaggccgaggtcgcgctgatcctcggcgccgacctcgacatgccc
aacccgaccgttgccgatgtgatcgcggcgaccgcctatgcggtgccggcgctggaagtg
gtcgccagccgcatcgccgactggaagatcggcatcctcgacaccatcgccgacaatgcc
tcggcgggcgcggtggtgctcggcgggccggcgcgccggctggacgggctggatctctcc
ggctgcgcgatggcgctgcggatcaacgacacgatcgtctccgaaggccgcggcgccgat
tgcctcggcaacccgctcaacgccgccgcctggctggccgcgcgcagccacgcgctgggc
cggccgctgcgcgccggcgaactgatcctcacgggcgctctcgggccgatgcggccggtc
gcccccggagacgccgtgcacgccgagatcgccgggctcggcaccgtctccgtcactttc
cgctga

DBGET integrated database retrieval system