KEGG   Sphingomonas sanxanigenens: NX02_18955Help
Entry
NX02_18955        CDS       T03929                                 

Definition
(GenBank) carbazole dioxygenase
  KO
K15751  carbazole 1,9a-dioxygenase [EC:1.14.12.22]
Organism
ssan  Sphingomonas sanxanigenens
Pathway
ssan00621  Dioxin degradation
ssan01100  Metabolic pathways
ssan01120  Microbial metabolism in diverse environments
ssan01220  Degradation of aromatic compounds
Module
ssan_M00544  Carbazole degradation, carbazole => 2-oxopent-4-enoate + anthranilate
Brite
KEGG Orthology (KO) [BR:ssan00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00621 Dioxin degradation
    NX02_18955
Enzymes [BR:ssan01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.12  With NADH or NADPH as one donor, and incorporation of two atoms of oxygen into the other donor
    1.14.12.22  carbazole 1,9a-dioxygenase
     NX02_18955
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aromatic_hydrox Rieske
Motif
Other DBs
NCBI-ProteinID: AHE55455
UniProt: W0AIH3
LinkDB All DBs
Position
4007177..4008337
Genome map
AA seq 386 aa AA seqDB search
MNEEPLVNPDVVSMIGDWKGYVEAKMGFRNHWYPVRFSKEIDEGQIEVIELLGEKLLLKR
IEGKVYAMRDRCLHRGVPLSRKPDCYTRDTITCWYHGYTYRFQTGELVNILAVPDSRLIG
RRRIVTYPVQEAKGLIFVFLGDEDAVHELKKDVPPGFLDEDLMVLGKHRVVNSNWRLGAE
NGFDALHIFIHKDTTLRHYRTFNFPIGHTPLPGAVQVVEDADGPKGVMDDFAQHTPVWDG
VIDGEVVVSGPRSAQVKGTSASVGTSIWLPGVLKVESFPTGGLTQFEWYVPLDGERHLYV
QTIGKACTTHDERIDFANAFEAIWKPHGLDGFNGDDIWAREVTEPFYADDFGWVDEMLCE
PDETILQWRRLASRHGRGVQQKSDLR
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaagagccgctggtcaatcccgacgtcgtcagcatgatcggggactggaagggc
tatgtggaagcgaagatgggcttccgcaaccactggtatccggtgcgcttctccaaggag
atcgacgagggccagatcgaggtgatcgaactgctcggcgaaaagctgctgctcaagcgc
atcgagggcaaggtctatgcgatgcgcgaccgctgcctccatcgcggcgtgccgctgtcc
cgcaagccggactgctataccagggacacgatcacctgctggtatcatggctatacctac
cgcttccagacgggcgagctggtcaacatcctcgcggtgcccgacagccggctgatcggt
cggcgcaggatcgtgacctatccggtgcaggaggcgaaggggctgatcttcgtgttcctg
ggcgacgaggatgcggtgcatgagctgaagaaggatgtgccgccgggcttcctcgacgag
gatctgatggtgctgggcaagcatcgcgtggtcaattcgaactggcggctgggtgccgag
aacggcttcgatgcgctgcacatcttcatccacaaggatacgacgctccgccactatcgc
accttcaacttcccgatcggccacaccccgctgcccggcgccgtccaggtcgtcgaggac
gcggatggccccaagggcgtgatggacgatttcgcgcagcacaccccggtgtgggacggc
gtgatcgatggcgaggtggtggtgagcggcccgcgttcggcgcaggtgaagggcacatcc
gcctcggtcggcacctcgatctggctgccgggcgtgctcaaggtggaaagctttcccacc
ggcgggctgacccagttcgaatggtatgtgccgctcgacggcgagcgccacctctatgtc
cagaccatcggcaaggcctgcacgacgcacgacgagcgcatcgatttcgccaacgcgttc
gaggcgatctggaagccgcacggcctcgacggtttcaacggcgacgacatctgggcgcgc
gaggtgaccgagcccttctatgccgacgatttcggctgggtcgacgagatgctgtgcgaa
cccgacgaaaccatcctgcagtggcgccgcctcgccagccggcacggccgcggcgtccag
cagaaatccgacctgcgctga

DBGET integrated database retrieval system