KEGG   Sphingomonas sanxanigenens: NX02_19000Help
Entry
NX02_19000        CDS       T03929                                 

Definition
(GenBank) acetaldehyde dehydrogenase
  KO
K04073  acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
ssan  Sphingomonas sanxanigenens
Pathway
ssan00360  Phenylalanine metabolism
ssan00362  Benzoate degradation
ssan00620  Pyruvate metabolism
ssan00621  Dioxin degradation
ssan00622  Xylene degradation
ssan00650  Butanoate metabolism
ssan01100  Metabolic pathways
ssan01120  Microbial metabolism in diverse environments
ssan01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ssan00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    NX02_19000
   00650 Butanoate metabolism
    NX02_19000
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    NX02_19000
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    NX02_19000
   00622 Xylene degradation
    NX02_19000
   00621 Dioxin degradation
    NX02_19000
Enzymes [BR:ssan01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     NX02_19000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh GFO_IDH_MocA NAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AHE55464
UniProt: W0AC19
LinkDB All DBs
Position
4014712..4015641
Genome map
AA seq 309 aa AA seqDB search
MKAAIIGSGNIGTDLMIKIMRRSDVLEMAAMAGIDPASDGLARAARMGVATTHAGIAGLE
ALAVWPEIGVVFDATSAGAHAGHSAAVTGAGKVMIDLTPAAIGPYVIPVVNGDAHLEASN
VNMVTCGGQATIPIVAAVASVATVHYAEIVASIASRSAGPGTRANIDEFTETTARAIEQV
GGAARGKAIIILNPAEPPMMMRDTVFTLSNGADEAAIAAAVEAMVARVRGYVPGYRLKQQ
VQFERFGSNDPVAIPGLGTFEGIKTTVFLEVEGAAHYLPAYAGNLDIMTSAALATAEKIA
ARRLVREAA
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccgcgatcatcggatcgggcaacatcggcaccgatctgatgatcaagatcatg
cgccggtccgacgtgctagagatggcggcgatggccgggatcgaccccgcgtcggacggg
ttggcgcgcgccgcgcggatgggcgtcgccaccacgcacgcggggatagcggggctcgaa
gcgctcgcggtatggcccgagatcggcgtcgtcttcgacgccacctccgcgggcgcgcat
gccgggcacagcgcggcggtgacgggcgcgggcaaggtgatgatcgacctgaccccggcg
gcgatcggcccctatgtcattcccgtcgtcaatggcgacgcgcatctcgaagcatccaac
gtcaacatggtgacctgcggcgggcaggcgacgatcccgatcgtcgcggcggtcgcctcg
gtcgcgacggtgcattatgccgagatcgtcgcctcgatcgcctcgcgctcggccggcccc
ggcacgcgcgcgaacatcgacgagttcaccgaaaccaccgcgcgcgcgatcgagcaggtg
gggggtgccgccaggggcaaggcgatcatcatactcaaccccgccgaaccgccgatgatg
atgcgcgacaccgtgttcaccctctcgaacggcgccgacgaggcggcgatcgctgcggcg
gtggaggcgatggtcgcgcgcgtccgcggctatgtgccgggctatcggctgaagcagcag
gtgcagttcgaacgcttcggctccaacgatccggtcgccatccccggcctcggcacgttc
gaggggatcaagaccacggtgttcctcgaggtcgagggcgcggcgcattatctgcccgcc
tacgccggcaatctcgacatcatgacctcggcggcgctggcgaccgcggagaagatcgcc
gcgcggcggctggtacgggaggcagcatga

DBGET integrated database retrieval system