KEGG   Sphingomonas sanxanigenens: NX02_19005Help
Entry
NX02_19005        CDS       T03929                                 

Definition
(GenBank) 4-hyroxy-2-oxovalerate aldolase
  KO
K01666  4-hydroxy 2-oxovalerate aldolase [EC:4.1.3.39]
Organism
ssan  Sphingomonas sanxanigenens
Pathway
ssan00360  Phenylalanine metabolism
ssan00362  Benzoate degradation
ssan00621  Dioxin degradation
ssan00622  Xylene degradation
ssan01100  Metabolic pathways
ssan01120  Microbial metabolism in diverse environments
ssan01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ssan00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    NX02_19005
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    NX02_19005
   00622 Xylene degradation
    NX02_19005
   00621 Dioxin degradation
    NX02_19005
Enzymes [BR:ssan01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.39  4-hydroxy-2-oxovalerate aldolase
     NX02_19005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like DmpG_comm DUF3866
Motif
Other DBs
NCBI-ProteinID: AHE55465
UniProt: W0AIJ2
LinkDB All DBs
Position
4015641..4016660
Genome map
AA seq 339 aa AA seqDB search
MDRKLYLQDVTLRDGMHAIRHRYGIDHVRAIARALDEARVDAIEVSHGDGLNGSSFNYGF
SAHTDWEWIEAVADVLDHAVLTTLLIPGIGTIEDLKHAHALGVRSVRVATHCTEADIARQ
HIMAARDLGMDVAGFLMMSHMIAPDALAAQAKRMEDYGAHCVYVTDSGGALDMDGYRERL
EAYDRVLKPETERGIHAHHNLSLGVANSIVGVQAGAIRIDASLAGMGAGAGNAPLEVFVA
AADRKGWNHGTDLFKLMDAAETLVRPLQDRPVRVDRETLSLGYAGVYSSFLRHAEKAAAD
HGLDTRQILVELGRRRMVGGQEDMIVDVALDLVAARNAA
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atggaccggaagctctatctgcaggacgtgaccttgcgcgacggcatgcacgcgatccgc
caccgctatggcatcgatcatgtccgcgcgatcgcccgcgcgctcgacgaggcgagggtc
gacgcgatcgaggtatcgcatggcgacgggctcaacggctcctcgttcaactatggcttc
agcgcgcacaccgactgggaatggatcgaggccgtcgcggacgtgctggaccatgccgtg
ctcaccaccttgctgatccccggcatcggcacgatcgaggatctgaagcacgcccatgcg
ctcggcgtccgctcggtgcgcgtcgcgacgcattgcaccgaggcggatatcgcgcgccag
cacatcatggcggcgcgcgacctcggcatggatgtcgccggcttcctgatgatgagccac
atgatcgcgcccgatgcgctcgccgcgcaggcgaagcggatggaggattatggcgcccac
tgcgtctacgtcaccgacagcggcggcgcgctcgacatggatggttatcgcgagcggctg
gaagcctatgaccgcgtgctcaagcccgaaaccgagcgcggcatccatgcgcaccacaac
ctctcgctcggcgtcgccaattcgatcgtcggcgtgcaggccggcgcgatccgcatcgac
gcaagccttgccggcatgggcgcgggcgccggcaacgcaccgctcgaggtcttcgtcgcc
gccgccgaccgcaagggctggaaccacggcaccgacctgttcaagctgatggacgccgcc
gaaacgctggtgcgaccgctgcaggaccggccggtgcgcgtcgatcgcgagacgctgagc
ctgggctatgccggcgtctattccagcttcctgcgccatgccgaaaaggccgcggccgac
catggcctcgacacccgccagatcctcgtcgagctcggccgccgccggatggtcggcggc
caggaggacatgatcgtcgacgtggcgctcgatctggtcgcggcgcgaaacgccgcctga

DBGET integrated database retrieval system