KEGG   Sphingomonas sanxanigenens: NX02_20215Help
Entry
NX02_20215        CDS       T03929                                 

Definition
(GenBank) xylose isomerase
  KO
K01805  xylose isomerase [EC:5.3.1.5]
Organism
ssan  Sphingomonas sanxanigenens
Pathway
ssan00040  Pentose and glucuronate interconversions
ssan00051  Fructose and mannose metabolism
ssan01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssan00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    NX02_20215
   00051 Fructose and mannose metabolism
    NX02_20215
Enzymes [BR:ssan01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     NX02_20215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: AHE55700
UniProt: W0AJ61
LinkDB All DBs
Position
complement(4275088..4276071)
Genome map
AA seq 327 aa AA seqDB search
MASEQKFGAGIWHFATYVDRYATDGYGAPRSLIEMIDLAGSVGDLSVVDINYPFADPKLS
LDAVDEALKRNKLEVIGITPEIYTREFSKGAFTNPDPGVRRRANELINDAANVVRRFGAK
YVKLWPGQDGWDYPFQVDHGDIWRKSLDGVGELAQQNPDLQFVIEYKPREPRNHMSFDSV
ARTLLGIEKIGLPNVGILLDFGHSLYGGESPADAAQLAIDYGRLFGMDVNDNLRGWDDDM
IAGSVHPIELFEFFYTLRRNNWEGVWQLDQFPFREDSVEAAKSAIGFLKRIERALDRLDF
DAMRAAQARQDAVTALNLARGALFGGE
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atggcgagcgaacagaagttcggcgcggggatctggcatttcgcgacctatgtcgatcgc
tacgcgaccgatggttacggcgccccgcgcagcctgatcgagatgatcgatctggcggga
tcggtgggtgatctttcggtggtcgacatcaactatccgttcgcggatcccaagctcagc
ctcgacgcggtggacgaggcgctcaagcgcaacaagctggaggtcatcggcatcacgcct
gagatctacacgcgcgaattctccaagggcgccttcaccaaccccgatccgggcgtgcgc
cgccgcgccaacgaactgatcaacgatgccgccaacgtcgtccgccgcttcggcgccaaa
tatgtgaagctgtggccggggcaggatggctgggattatccgttccaggtcgatcatggc
gacatctggcgcaagagcctcgacggcgtcggcgaactggcgcagcagaaccccgacctg
cagttcgtcatcgagtacaagccgcgcgagccgcgcaaccatatgagcttcgacagcgtc
gcgcgcaccttgctcggcatcgagaagatcggcctgcccaatgtcggcatcctgctcgac
ttcggtcactcgctctatggcggggaatcgcccgcggacgcggcgcagcttgcgatcgac
tatggtcgcctgttcggcatggacgtgaacgacaatctgcgcggctgggacgacgacatg
atcgccggctcggtccacccgatcgaactgttcgaattcttctacacgctgcgccggaac
aactgggagggggtgtggcagctcgaccagttcccgttccgcgaagacagcgtggaagcg
gcgaagagcgcgatcggcttcctcaagcgcatcgaacgcgcgctcgaccggctcgacttc
gacgcgatgcgtgccgcgcaggcgaggcaggatgcggtcaccgcgctgaacctcgcgcgc
ggcgcgctgttcggcggagagtga

DBGET integrated database retrieval system