KEGG   Sphingomonas sanxanigenens: NX02_22180
Entry
NX02_22180        CDS       T03929                                 

Definition
(GenBank) thioredoxin-disulfide reductase
  KO
K00384  thioredoxin reductase (NADPH) [EC:1.8.1.9]
Organism
ssan  Sphingomonas sanxanigenens
Pathway
ssan00450  Selenocompound metabolism
Brite
KEGG Orthology (KO) [BR:ssan00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    NX02_22180
Enzymes [BR:ssan01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.9  thioredoxin-disulfide reductase
     NX02_22180
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 cNMP_binding Pyr_redox K_oxygenase Thi4 FAD_oxidored NAD_binding_8 HI0933_like FAD_binding_3 GIDA FMO-like DAO FAD_binding_2
Other DBs
NCBI-ProteinID: AHE56059
UniProt: W0ADV4
LinkDB
Position
complement(4629851..4631476)
AA seq 541 aa
METIGRDLREMQRIPLAAAHVAALRQAGVERDYPAGAFLARPGEPADRFIYVEDGEIEVV
NPLTGDRHLPSTLGPTQFMGEISFLDGGNWSMPMRTARPTRVIEVARAAMLRLMADIPEM
SDIVITVLAARRRRQLDARDSALILIGEDVDRAIGRVADFASRNRIPYTSLPLGSAAAGE
AARSCASTATGPMAIFGRTVIADPTPERIARLLGLGRELVNDEAFDVIIIGGGPAGVAAG
VYAGAEGLRALVVEDIAVGGQAGTSSRIENYMGFPTGISGADLVWRGEVQAMKFGTRFAV
PRRVGLLEQLDDGDFCATLDNGQRVRARAVVVATGVQYRRLPIERLADLEGAGIYYAATE
NEARTCHGREAVVIGGGNSAGQAAMYLSRAARRVRVLVRGTSLAASMSHYLSSRLEADPA
ISIDYGAEVVALHGDDRLDQVTIRDRATGGERRIDACALFIMVGAAPNTEWLAGLVRLDD
KGFILTGEAAGGRSSFATSRAGIFAVGDVRAHSVKRVASSVGEGSVVISQVWEHLNPAVP
R
NT seq 1626 nt   +upstreamnt  +downstreamnt
atggagaccatagggcgcgatctgcgtgaaatgcagcgaatcccgctcgctgcggcgcat
gtcgccgcgctccggcaggcgggtgtcgagcgcgactatccggccggcgccttcctcgcc
cgccccggcgaaccggcggaccgcttcatctatgtcgaggacggcgagatcgaggtggtc
aatccgctgaccggcgaccgccatctgccgtcgacgctggggccgacccagttcatgggc
gagatatcgtttctggacggcggcaactggtcgatgccgatgcgcacggcgcggccgacg
cgggtgatcgaggtcgcgcgcgccgcgatgctgcggctgatggcggacattcccgagatg
tcggacatcgtcatcaccgtgctcgccgcgcggcgccgtcgccagctcgacgcgcgggac
agcgcgctgatcctgatcggcgaggatgtcgaccgcgcgatcggccgcgtcgccgatttc
gccagccgcaaccggattccctacacctcgctgccgttggggagcgcggcggcgggagag
gcggcgcgcagctgcgccagcaccgcgaccgggccgatggcgatcttcgggcgcacggtg
atcgcggatccgacgcccgaacgcatcgcccggttgctggggctcggccgcgaactcgtc
aacgacgaggcgttcgacgtcatcatcatcggcggcggcccggcgggtgtcgcggcgggc
gtctatgccggcgccgaggggctgcgcgcgctggtggtggaggatatcgcggtcggcggc
caggccggcacctccagccggatcgagaattatatgggcttccccaccggcatttcgggc
gccgatctcgtctggcgcggcgaggtgcaggcgatgaaattcggcacgcgcttcgcggtg
ccccgccgcgtcggcttgctcgaacagctcgacgacggcgatttctgcgccaccctggac
aatggccagcgcgtgcgcgcccgcgccgtcgtggtggcgacgggggtgcagtatcgccgc
ctgccgatcgagcggctcgccgatctcgaaggcgccggcatctattatgccgcgaccgag
aacgaggcgcgcacctgccatggccgcgaggcggtggtgatcggcggcggcaattcggcg
ggtcaggcggcgatgtatctcagccgcgcggcgcgccgcgtccgcgtgctggtgcgcggg
acctcgctcgccgcgtcgatgtcgcactatctgtcgagccggctggaggcggatccggcg
atcagcatcgattatggcgccgaggtggtggcgctgcatggcgacgatcggctcgaccag
gtcaccatccgcgatcgcgccaccggcggggagcggcggatcgacgcctgcgcgctgttc
atcatggtcggggccgctcccaacaccgaatggctcgccgggctggtgcggctcgacgac
aagggcttcatcctgaccggggaggccgccggcggacgatcctccttcgccacctcgcgc
gccggcatcttcgcggtcggcgatgtccgcgcgcattcggtaaagcgcgtcgcctcgtcg
gtcggcgagggttcggtcgtgatctcgcaggtgtgggagcatctgaaccccgcggttccg
cgctga

DBGET integrated database retrieval system