KEGG   Sphingomonas sanxanigenens: NX02_22880
Entry
NX02_22880        CDS       T03929                                 

Definition
(GenBank) L-aspartate oxidase
  KO
K00278  L-aspartate oxidase [EC:1.4.3.16]
Organism
ssan  Sphingomonas sanxanigenens
Pathway
ssan00250  Alanine, aspartate and glutamate metabolism
ssan00760  Nicotinate and nicotinamide metabolism
ssan01100  Metabolic pathways
Module
ssan_M00115  NAD biosynthesis, aspartate => quinolinate => NAD
Brite
KEGG Orthology (KO) [BR:ssan00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    NX02_22880
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    NX02_22880
Enzymes [BR:ssan01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.16  L-aspartate oxidase
     NX02_22880
SSDB
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 DAO Thi4 HI0933_like NAD_binding_8 FAD_binding_3 Lycopene_cycl YscO
Other DBs
NCBI-ProteinID: AHE56194
UniProt: W0AE74
LinkDB
Position
complement(4791385..4792977)
AA seq 530 aa
MHHSFDVVIVGSGAAGLTAALNLATRFKVAVIAKGGLSEGSTAWAQGGIAAVLEKGDTFD
SHIEDTMVAGAGLNRRETVEYVVEHAPAAIRRLIDIGVPFNQEAGALHLTREGGHSHRRI
VHVDDATGWAVQQALEKAARANPNISLIPDMAAIDLVTGRHGERYSGDGRVWGVYAASRQ
TGRVELFTGRATILATGGAGRTYIYSTAPRGATGDGIAMAWRAGARISNMEFMQFHPTCL
YNLEVKNFLITEAVRGEGGLLKLPPGVQGGGERFMPRFDPRGELAPRDVVARAIDHEIKR
LGLDYVHLDISHKPADFVKGHFPNIYSRLIDLGIDITTQPIPVVPAQHYTCGGILVDLKG
RTDLPGLYAVGECTQSGLHGANRLASNSLLECFVFGEAAAAHIGRHFDELPAPPPIRAWD
ESRVTDSDEEVIVQHNWREIRRFMWDYVGIVRTTKRLERAQHRIAMLRQEVADYYGHFRV
TPDLIELRNLVEVADLIVRSALHRQESRGLHYTLDYPDTLAEAVDTILVP
NT seq 1593 nt   +upstreamnt  +downstreamnt
ttgcatcatagtttcgacgtcgtcatcgtcgggtccggcgcggccggcctcaccgccgca
ctgaaccttgccacccgcttcaaggtcgcggtgatcgccaagggcgggctttccgagggc
tcgaccgcctgggcgcagggcggcatcgccgcggtgctcgagaaaggcgacacgttcgac
agccatatcgaggatacgatggtcgcaggcgccgggctcaaccggcgcgagacggtggaa
tatgtcgtcgagcatgcgccggcggcgatccgccggctcatcgatatcggcgtgcctttc
aaccaggaagccggtgcgctgcacctgacgcgcgagggcgggcacagccatcgccgcatc
gtccatgtcgacgacgccaccggctgggcggtgcagcaggcgctggaaaaggcggcgcgc
gccaatcccaacatcagcctgatcccggatatggcggcgatcgacctcgtcaccggccgc
catggcgagcgctattcgggcgacggccgtgtctggggcgtctacgccgccagccgccag
accggccgcgtcgagctgttcaccggccgcgcgacgatcctcgccaccggcggggcgggg
cgcacctatatctattcgacggcaccgcgcggcgcgaccggggatggcattgcgatggcg
tggcgcgccggcgcgcgcatctccaatatggaattcatgcagttccacccgacctgcctc
tacaatctggaggtcaagaacttcctgatcaccgaggcggtgcgcggcgagggcgggctg
ctcaagctgccgccgggggtgcagggcggcggcgagcgcttcatgccgcgcttcgatccc
cgcggcgaactggcgccgcgcgacgtcgtcgcccgcgcgatcgatcatgagatcaagcgg
ctcggcctcgactatgtccatctcgacatcagccataagccggccgacttcgtgaagggg
catttccccaacatctacagccggctgatcgacctcggcatcgacatcaccacccagccc
atcccggtggtgcccgcgcagcattatacctgcggcggcatattggtggacctgaagggg
cgcaccgacctgcccggcctctacgcggtgggcgagtgcacccagtccggcctgcacggc
gccaatcgcctcgcctccaactcgctgctcgaatgtttcgtgttcggcgaggcggcggcg
gcgcatatcggccgccatttcgacgaactgcccgccccgccgccgatccgcgcgtgggac
gagagccgcgtgaccgattcggacgaagaagtcatcgtccagcacaactggcgcgagatt
cggcgcttcatgtgggactatgtcggcatcgtgcgcaccaccaagcggctggagcgcgcg
cagcaccgcatcgcgatgctgcgacaggaggtcgccgactattacggccatttccgggtg
acgcccgacctgatcgagctgcgcaacctcgtggaggtggccgatctgatcgtgcgatcg
gcgctgcaccgccaggaaagccgcggcctgcactacacgctcgattatccggacaccttg
gccgaggcggtggacaccatcctggtgccctga

DBGET integrated database retrieval system