KEGG   Sphingomonas sanxanigenens: NX02_24620
Entry
NX02_24620        CDS       T03929                                 

Definition
(GenBank) nitrite reductase
  KO
K00362  nitrite reductase (NADH) large subunit [EC:1.7.1.15]
Organism
ssan  Sphingomonas sanxanigenens
Pathway
ssan00910  Nitrogen metabolism
ssan01100  Metabolic pathways
ssan01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ssan00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    NX02_24620
Enzymes [BR:ssan01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.15  nitrite reductase (NADH)
     NX02_24620
SSDB
Motif
Pfam: Pyr_redox_2 NIR_SIR Fer2_BFD Rubredoxin_C Pyr_redox NIR_SIR_ferr DAO Pyr_redox_3 FAD_binding_2 NAD_binding_8 GIDA AlaDh_PNT_C 3HCDH_N
Other DBs
NCBI-ProteinID: AHE56531
UniProt: W0AHF6
LinkDB
Position
5168914..5171385
AA seq 823 aa
MTHIHHRDHLVVIGNGMAGCRAVEEILARDPHRYKVTIFGAEPHVNYNRIMLSPVLAGEK
RFDEIVINDRSWYLDHGIELIAADPVTAIDRAAKTVTSKAGRTVSYDRLLIATGSDPFII
PVPGKDLPGVISFRDMADVDAMLAAAAQGGDAVVIGGGLLGLEAAHGLSLRGMKVTVLHL
MPTLMERQLDEAAGWLLKTALEGRGQTIITGADTAEIVGDGKVEGVRLKDGREIPASLVV
MAVGIRPNTALARDAGLAVGRGIQVDDDMVTSDPAILAVGECVEHRGQVYGLVAPLWEMC
RALADGCTTGCTGYRGSVTSTKLKVSGIDVFSAGDFSGGDGTEDIVLRDAARGVYKRVVV
KDDRVVGAVLYGDTADGSWYFDLLRKGEDISDVRDALIFGQAFAAGGGAADPKAAVAALS
DDAEICGCNGVSKGKVVATIQGGACTLDAVRGSCKASASCGSCTGLVESLLALTLGDDYA
GARAVKTMCKCTSFGHDDVRREIVLQNMASIPEVMQKLHWSTPDGCASCRPALNYYLLCA
NPADYVDDQQSRFVNERMHANIQKDGTYSVVPRMWGGLTTPQELRAIADVVEKYDAPMVK
VTGGQRLDIFGIRKEDLPAVWADLNAAGMVSGHAYGKALRTVKTCVGSEWCRFGTQDSTG
LGVKLERGFWGSWMPHKFKMAVSGCPRNCAEATIKDFGVVCVDSGYELHVGGNGGIHVRA
TDFLVKVGTEEEAMHYAAAFVQLYREEARYLERTAPWIERVGLAYIKARVVEDEEGRDSL
ASRFWFSQQFAQDDPWEQRAAGADRNLHRPLAEIRPLPAFEGA
NT seq 2472 nt   +upstreamnt  +downstreamnt
atgacccacattcaccaccgcgaccatctcgtcgtgatcggcaacggcatggccggctgc
cgcgcggtcgaggaaatcctcgcgcgcgatccgcaccgctacaaggtgacgatcttcggc
gccgaaccgcatgtgaactataaccgcatcatgctctcaccggtgctcgcgggcgagaag
cgcttcgacgagatcgtgatcaacgatcggagctggtatctcgatcatggcatcgaactg
atcgcggcggaccccgtgacggcgatcgaccgcgccgcgaagacggtgacgtcgaaggcg
ggcaggaccgtctcctacgaccggctgctgatcgccaccggttccgatcccttcatcatc
ccggtgccgggcaaggacctgccgggcgtgatcagctttcgcgacatggccgatgtcgat
gcgatgctcgccgccgcggcgcagggcggcgacgcggtggtgatcggcggcggcctgctc
gggctggaggcggcgcatggcctgtcgctgcgtggcatgaaggtgacggtgctgcacctg
atgccgaccctgatggagcggcagctcgacgaggcggcgggctggctgctcaagaccgcg
ctcgaaggccgcggccagacgatcatcaccggcgccgacaccgccgagatcgtcggcgac
ggcaaggtcgaaggcgtgcggctgaaggacggtcgcgagatcccggcgagcctggtggtg
atggcggtgggcatccgccccaacaccgcgctggcgcgcgacgccggcctcgcggtcggc
cgcggcatccaggtcgatgacgatatggtcacctccgatccggcgatcctcgcggtcggc
gaatgcgtggagcatcgcggccaggtctatgggctggtcgcgccgctgtgggagatgtgc
cgcgcgctggcggacggctgcaccaccggctgcaccggctatcggggctcggtcacctcg
accaagctcaaggtctccggcatcgacgtgttctccgcgggcgacttttcgggcggggac
ggcacggaggacatcgtgctgcgcgacgccgcgcgcggcgtctacaagcgcgtggtggtg
aaggacgaccgcgtcgtcggcgcggtgctctatggcgataccgcggacggcagctggtat
ttcgacctgctcaggaagggcgaggatatctccgacgtccgcgatgcgctgatcttcggc
caggccttcgccgccggaggcggcgcggcggaccctaaggcggccgttgcggcgctctcg
gacgatgccgagatctgcggctgcaacggcgtctccaagggcaaggtggtcgccaccatc
cagggcggcgcctgcacgctcgacgcggtgcgcggcagctgcaaggcatcggcctcgtgc
gggtcctgcaccggcctcgtcgaaagcctgctcgcgctgactctcggcgacgattatgcc
ggcgcgcgcgcggtcaagacgatgtgcaaatgcaccagcttcggccatgacgacgtccgc
cgcgagatcgtgctgcagaacatggcctcgatccccgaggtgatgcagaagctgcactgg
tcgacgcccgatggctgcgcctcgtgccggccggcgctcaactactacctgctctgcgcc
aaccccgccgactatgtcgacgaccagcagagccgcttcgtcaacgagcggatgcacgcc
aacatccagaaggacggcacctattcggtggtgcccaggatgtggggcgggctcaccacc
ccgcaggaactgcgcgcgatcgccgatgtcgtcgagaaatatgacgcgccgatggtgaag
gtgacgggcggccagcggctcgacatcttcggcatcaggaaggaagatctgcccgcggta
tgggccgatctcaacgccgccggcatggtttccggccacgcctatggcaaggcgctgcgc
acggtgaagacctgcgtcggttccgaatggtgccgcttcggcacgcaggattcgaccggg
ctcggcgtgaagcttgaacgcggcttctggggcagctggatgccgcacaagttcaagatg
gcggtcagcggctgcccccggaactgcgccgaggcgacgatcaaggatttcggcgtggtc
tgcgtcgacagcggttacgaactgcatgtcggcggcaatggcggcatccacgtccgcgcc
accgacttcctcgtgaaggtcggcaccgaggaagaggcgatgcattatgccgccgccttc
gtgcagctctatcgcgaggaggcgcgctatctggagcgcaccgcgccgtggatcgagcgc
gtcggccttgcctatatcaaggcgcgggtggtggaggatgaggaggggcgcgacagcctc
gcctcgcgcttctggttcagccagcaattcgcacaggacgatccgtgggagcagcgcgcc
gccggcgccgaccgcaacctccaccgccccctcgccgaaatccgtccgcttcccgccttc
gaaggagcctga

DBGET integrated database retrieval system