KEGG   Sphingomonas sanxanigenens: NX02_26165Help
Entry
NX02_26165        CDS       T03929                                 

Definition
(GenBank) methionine gamma-lyase
  KO
K01761  methionine-gamma-lyase [EC:4.4.1.11]
Organism
ssan  Sphingomonas sanxanigenens
Pathway
ssan00270  Cysteine and methionine metabolism
ssan00450  Selenocompound metabolism
ssan01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssan00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    NX02_26165
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    NX02_26165
Enzymes [BR:ssan01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.11  methionine gamma-lyase
     NX02_26165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cys_Met_Meta_PP Met_gamma_lyase DHQ_synthase
Motif
Other DBs
NCBI-ProteinID: AHE56830
UniProt: W0AM97
LinkDB All DBs
Position
5487026..5488351
Genome map
AA seq 441 aa AA seqDB search
MTDKPNEADLTGVTPRKNPKPPIDDIGGRALKPATLMMGYGYDPMLSEGSLKPPIFLTST
FVFPNAAAGKRHFEGVTGKRPGGAEGLVYSRFNGPNQEILEDRLGVWEDAEDALTFSSGM
SAIATLFLSMVRPGDTIVHSGPLYAATETLIARVLGRFGIHWLDFPAGATQDEIEAVLGK
AASGRVALIYLESPANPTNALVDVEAVVAARKTVFGDAAEQPPIAIDNTFLGPLWHKPLA
HGADLVVYSLTKYAGGHSDLVAGGVLGRKSLIDVIRAMRNTIGTITDPNTAWMLLRSLET
LELRMTRAGENAAKVCAFLRDHPKVERVGYLGFLQDEPGQERQADIYRRHCSGAGSTFSL
FLKGGEKESFAFLDALRIAKLAVSLGGTETLASHPAAMTHLSVPDARKRALGITDNLVRI
SIGVEDADDLIADFAQALDRV
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacaagccgaacgaagccgacctgaccggcgtgacgccgcgcaagaaccccaag
ccgccgatcgacgatatcggcgggcgggcgctcaagccggcgaccctcatgatgggatat
ggctatgatccgatgctgtccgaaggatcgctgaagccgccgatcttcctgacctcgacc
ttcgtcttccccaatgccgccgcgggcaagcgccatttcgaaggggtcaccggcaagcgc
ccgggcggtgccgagggtctggtctattcgcggttcaacggccccaaccaggaaatcctc
gaggatcggctgggcgtgtgggaggatgccgaggacgcgctgaccttctcctcgggcatg
tcggcaatcgccacgctgttcctgtcgatggtgcggccgggcgacacgatcgtccattcg
gggccgctctatgccgccacggaaacgctgatcgcgcgcgtgctcggccgtttcggcatc
cactggctcgatttccccgccggcgcgacgcaggacgagatcgaggcggtgctcggcaag
gcggcatcggggcgggtcgcgttgatctatctcgaaagcccggccaatcccaccaacgcg
ctggtcgacgtcgaggcggtggtcgcggcgcgcaagacggtgttcggcgatgccgcggag
cagcctccgatcgcgatcgacaacaccttcctcgggccgctctggcacaagccgctggcg
catggcgccgatctggtggtctattcgctcaccaaatatgccggtggccacagcgatctc
gtcgccggcggcgtgctcggccggaagagcctgatcgatgtgatccgcgcgatgcgcaac
acgatcggcacgattaccgatcccaacactgcctggatgctgctgcgcagcctggagacg
ctggaactgcggatgacgcgtgcgggcgagaatgccgccaaggtctgcgcgttcctgcgc
gaccatcccaaggtggagcgcgtcggctatctcggcttcctgcaggatgagcccgggcag
gaacggcaggcggacatctaccgccgccactgcagcggcgccggctcgaccttttcgctg
ttcctgaagggcggcgaaaaggagagcttcgcgttcctcgacgcgctgcgcatcgccaag
ctggcggtgagcctcggcggcaccgagaccctggcgagccaccccgcggcgatgacgcac
ctgtccgtgcccgacgcccgcaagcgcgcgctgggcatcaccgacaatctggtacggatc
tcgatcggcgtcgaggatgcggacgatctgatcgccgacttcgcgcaggccttggacagg
gtttga

DBGET integrated database retrieval system