KEGG   Sphingomonas sanxanigenens: NX02_p1305Help
Entry
NX02_p1305        CDS       T03929                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
ssan  Sphingomonas sanxanigenens
Pathway
ssan00010  Glycolysis / Gluconeogenesis
ssan00071  Fatty acid degradation
ssan00350  Tyrosine metabolism
ssan00625  Chloroalkane and chloroalkene degradation
ssan00626  Naphthalene degradation
ssan01100  Metabolic pathways
ssan01110  Biosynthesis of secondary metabolites
ssan01120  Microbial metabolism in diverse environments
ssan01130  Biosynthesis of antibiotics
ssan01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ssan00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NX02_p1305
  09103 Lipid metabolism
   00071 Fatty acid degradation
    NX02_p1305
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    NX02_p1305
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    NX02_p1305
   00626 Naphthalene degradation
    NX02_p1305
Enzymes [BR:ssan01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     NX02_p1305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C Glu_dehyd_C TrkA_N 2-Hacid_dh_C Urocanase
Motif
Other DBs
NCBI-ProteinID: AKH18902
UniProt: A0A0F7JTB1
LinkDB All DBs
Position
pNXO2:complement(268074..269102)
Genome map
AA seq 342 aa AA seqDB search
MESTMKAAVVREFGKPLVMEEVAVPRPGAGQILVKIAATGVCHTDLHAAEGDWPVKPNPP
FIPGHEGVGHVVAVGAGVKHVKEGDRVGVPWLYDACGHCTHCLGGWETLCEEQHNTGYSV
NGSFAEYVLADPNYVGHLPGNVSFVDIAPILCAGVTVYKGLKVTDTKPGDWVVISGIGGL
GHLAVQYAKAMGLNVVAVDVDDRKLDLARSLGATLAVNARSEDPIAFVKKQIGGANGVLV
TAVSPKAFEQAMGMVGRGGTVALNGLPPGDFPLPIFDTVLNGVTVRGSIVGTRLDLQEAL
DFAGDGKVKATISTDKLENINDIFSRMHKGDIQGRVVIDFEQ
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atggaaagcacgatgaaagccgcggtcgtccgtgaattcggaaagccattggtcatggag
gaagtcgcggtgccccgacctggcgccggccagatcctcgtcaagatcgcagccaccggt
gtgtgccacaccgacctgcatgccgctgagggcgattggccggtcaagcccaatccaccc
ttcattcctggtcacgagggcgtcggacatgtggtcgcggttggcgcaggtgtgaagcat
gtcaaggagggcgaccgggtgggcgtgccatggctatatgatgcctgcggccattgcacg
cactgcctgggcggctgggaaacgctgtgcgaggagcagcacaataccgggtattcggtg
aacggcagctttgccgaatatgttctcgccgatcccaattatgtggggcatctgcccggc
aacgtttcgttcgtcgatattgcgccgatcctgtgcgccggcgtcaccgtctacaagggc
ctcaaggtaaccgacaccaaaccgggcgactgggtggtgatctccggcatcggaggtctc
ggccatctcgccgtgcaatatgccaaggcgatgggcctcaacgtcgtcgccgtcgatgtc
gatgacaggaagctcgacctcgcccggtcgctgggggccacgttggcagtcaacgcccgt
tcggaagacccgatcgctttcgtgaagaagcagatcggaggcgcgaatggggtgttggtc
accgccgtgtcgcccaaggccttcgaacaggcgatgggtatggtgggacgcggcggcacg
gtcgcgctcaacggcctgccgcccggtgacttcccgctgccgatcttcgacacggtgctg
aacggcgtgaccgtgcggggatcgatcgtggggacgcggctcgatttacaggaagccttg
gacttcgccggtgacggcaaggtgaaggccacgatctcaaccgacaaactcgagaacatc
aacgacatcttctcccggatgcacaagggcgacatccagggccgcgtcgtcatcgatttc
gagcaataa

DBGET integrated database retrieval system