KEGG   Sphingomonas sanxanigenens: NX02_p1335
Entry
NX02_p1335        CDS       T03929                                 

Definition
(GenBank) thioredoxin reductase
  KO
K00384  thioredoxin reductase (NADPH) [EC:1.8.1.9]
Organism
ssan  Sphingomonas sanxanigenens
Pathway
ssan00450  Selenocompound metabolism
Brite
KEGG Orthology (KO) [BR:ssan00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    NX02_p1335
Enzymes [BR:ssan01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.9  thioredoxin-disulfide reductase
     NX02_p1335
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox NAD_binding_8 DAO FAD_binding_3 NAD_binding_7 FAD_binding_2 HI0933_like Thi4 Trp_halogenase
Other DBs
NCBI-ProteinID: AKH18908
UniProt: A0A0F7JW76
LinkDB
Position
pNXO2:275396..276394
AA seq 332 aa
MMRLRLTNQGWTGDPEEVIDCLIVGGGPAGLTTAIYLSRFLRSCVVFDTAAGRAASIPRS
HNLPGFPGGISGVTFLARLQAQLHEYGGTIQSGEIDAIVASGDHFSASCGLNVMYARTVV
LATGVVNRRPEMPDAMHDIGVARGLIRYCPICDGYEARRMNVAVLGCDGHGAEEAEFLRA
YGAKVTLLAERSLDLAPMEFAKLNQQGIDVAPSPVEQLRLGECVEVRLANGLGLQFDTLY
PALGSSPRTRLATSLGAKLSESGCVLTNAHQQSSVAGLYAVGDVVEGLDQISVATGQAAI
AATAIHNLLRDSDSGLASAMAGLCPARGVLPT
NT seq 999 nt   +upstreamnt  +downstreamnt
atgatgaggttgcggttgaccaatcaaggctggactggcgatcccgaggaggtcatcgac
tgtctgattgtgggcggcggtcccgcaggcctcacgaccgcgatctatctgtcccggttt
ctcaggagctgcgtcgtcttcgacacggcggcagggcgcgccgcctccatcccgcgctcg
cacaaccttccaggatttcccggcggcatttccggcgtcacgtttcttgcgcgcctgcaa
gctcagctgcacgaatatggcggtacgatccagagcggtgagatcgacgcgattgtcgca
tcaggcgaccatttctcggcaagctgcggactgaacgtcatgtacgcgcggaccgtggtc
ctcgcgaccggggtcgtcaatcgacgtccagagatgcccgatgcgatgcatgacatcggc
gtcgcgcgtggtcttattcgctactgcccgatttgcgatggttatgaggctcggcggatg
aacgtggcggtgctcggctgcgacggccatggcgctgaagaagccgaatttctgcgcgct
tatggcgccaaggtcacgcttctcgccgaacggtcgctcgacctcgctccaatggaattt
gccaagctgaaccagcagggcatcgatgtcgcgccttcgcctgtcgagcagctgcgtctg
ggcgagtgtgtcgaggtgcggttggccaacggcctggggctacaattcgacacgctttac
cctgcgctcggctcgtcgcctcgaacgcggcttgccacttcgctgggcgcgaagctcagc
gaatcaggttgcgtgctgaccaacgcccaccaacaatcctctgttgctggcctttacgcg
gttggcgacgttgtggaagggctcgatcagatcagcgtcgcgaccggacaagcagcgatc
gctgcgaccgcaatccataacctgttgcgcgacagcgacagcggattggcatccgccatg
gccgggctgtgtcccgctcggggcgtactgccgacctag

DBGET integrated database retrieval system