KEGG   Streptococcus suis BM407 (serotype 2): SSUBM407_0538Help
Entry
SSUBM407_0538     CDS       T00935                                 

Gene name
tufA
Definition
(RefSeq) elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
ssb  Streptococcus suis BM407 (serotype 2)
Brite
KEGG Orthology (KO) [BR:ssb00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:ssb03012]
    SSUBM407_0538 (tufA)
   03029 Mitochondrial biogenesis [BR:ssb03029]
    SSUBM407_0538 (tufA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ssb04147]
    SSUBM407_0538 (tufA)
Translation factors [BR:ssb03012]
 Eukaryotic Type
  Elongation factors
   SSUBM407_0538 (tufA)
 Prokaryotic Type
   SSUBM407_0538 (tufA)
Mitochondrial biogenesis [BR:ssb03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    SSUBM407_0538 (tufA)
Exosome [BR:ssb04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   SSUBM407_0538 (tufA)
  Exosomal proteins of breast cancer cells
   SSUBM407_0538 (tufA)
  Exosomal proteins of colorectal cancer cells
   SSUBM407_0538 (tufA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase GrpE
Motif
Other DBs
NCBI-GeneID: 8154963
NCBI-ProteinID: YP_003028301
UniProt: A0A0H3MUB0
LinkDB All DBs
Position
593671..594867
Genome map
AA seq 398 aa AA seqDB search
MAKEKYDRSKPHVNIGTIGHVDHGKTTLTAAITTVLARRLPSSVNQPKDYASIDAAPEER
ERGITINTAHVEYETEKRHYAHIDAPGHADYVKNMITGAAQMDGAILVVASTDGPMPQTR
EHILLSRQVGVKHLIVFMNKVDLVDDEELLELVEMEIRDLLSEYDFPGDDLPVIQGSALK
ALEGDSKYEDIVMELMNTVDEYIPEPERDTDKPLLLPVEDVFSITGRGTVASGRIDRGTV
RVNDEIEIVGLQEEKSKAVVTGVEMFRKQLDEGLAGDNVGVLLRGVQRDEIERGQVISKP
GSINPHTKFKGEVYILTKEEGGRHTPFFDNYRPQFYFRTTDVTGSIKLPEGTEMVMPGDN
VTIDVELIHPIAVEQGTTFSIREGGRTVGSGMVTEIEA
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagaaaaatacgatcgtagtaaaccacacgttaacattggtacaattggacac
gttgaccacggtaaaactactttgacagcagctatcacaactgtattggcacgtcgcttg
ccttcatcagttaaccaacctaaagactatgcgtctatcgatgctgctccagaagagcgc
gagcgcggtatcactatcaacactgcacacgttgagtacgaaactgaaaaacgtcactat
gctcacatcgacgctccaggacacgcggactacgttaaaaacatgatcactggtgctgct
cagatggacggtgcgatccttgtagtagcttcaactgacggtccaatgccacaaactcgt
gagcacatccttctttcacgtcaggttggtgttaaacaccttatcgtcttcatgaacaaa
gttgacttggttgacgatgaagaattgcttgagttggttgaaatggaaatccgtgacctt
ctttcagaatacgatttcccaggtgatgatcttccagttatccaaggttcagctcttaaa
gctcttgaaggtgactctaagtacgaagacatcgttatggaattgatgaacactgttgat
gagtacattccagaaccagaacgcgacactgacaaaccattgttgcttccagtcgaggac
gtattctcaatcactggtcgtggtactgtagcttcaggacgtatcgaccgtggtactgtt
cgtgtcaacgacgaaatcgaaatcgttggtcttcaagaagaaaaatctaaagcagttgtt
actggtgttgaaatgttccgtaaacaacttgacgaaggtcttgccggcgataacgttggt
gtgcttcttcgtggtgtacaacgtgatgaaatcgaacgtggtcaagttatctctaaacca
ggttctatcaacccacacactaaattcaaaggtgaagtttacatccttactaaagaagaa
ggtggacgtcacactccattcttcgacaactaccgtccacagttctacttccgtacaact
gacgtaactggttcaatcaaattgccagaaggtactgaaatggtaatgcctggtgataac
gttactatcgacgttgaattgatccacccaatcgccgttgaacaaggtactactttctct
atccgtgaaggtggacgtactgttggttcaggtatggttacagaaatcgaagcttaa

DBGET integrated database retrieval system