KEGG   Streptococcus suis BM407 (serotype 2): SSUBM407_0605Help
Entry
SSUBM407_0605     CDS       T00935                                 

Gene name
ddlA
Definition
(RefSeq) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
ssb  Streptococcus suis BM407 (serotype 2)
Pathway
ssb00473  D-Alanine metabolism
ssb00550  Peptidoglycan biosynthesis
ssb01100  Metabolic pathways
ssb01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ssb00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    SSUBM407_0605 (ddlA)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SSUBM407_0605 (ddlA)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    SSUBM407_0605 (ddlA)
Enzymes [BR:ssb01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     SSUBM407_0605 (ddlA)
Peptidoglycan biosynthesis and degradation proteins [BR:ssb01011]
 Precursor biosynthesis
  Amino acid ligase
   SSUBM407_0605 (ddlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4
Motif
Other DBs
NCBI-GeneID: 8153616
NCBI-ProteinID: YP_003028367
UniProt: A0A0H3MUI1
LinkDB All DBs
Position
672911..673957
Genome map
AA seq 348 aa AA seqDB search
MSKETLILLYGGRSAEREVSVLSAESVMRAINYDKFFVKTYFISQTGDFIKTQEFSQTPS
ADEKLMTNATIVEEQKIRPSDIYEEKAVVFPVLHGPMGEDGSIQGFLEVLRMPYVGTNIL
SSSVAMDKITTKRVLESAGISQVPYVAVIEGENIDDKIAEIEGKLTYPVFVKPANMGSSV
GISKAEDLAGLRKALDLAFKYDSRVLVEQGVNAREIEVGLLGNADVKTTLPGEVVKDVAF
YDYDAKYIDNKITMEIPAKIDESIMDIMRDNAAKAFRAIGGCGLSRCDFFLTEDGDIFLN
ELNTMPGFTQWSMYPLLWDNMGLAYPDLIEELVRLAKEMFEKRESHLI
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaagaaaccttgattttactatatggtgggcgttctgcagagcgtgaggtatct
gttctgtctgccgaaagcgtcatgcgtgctatcaattatgataaattttttgtcaaaacc
tatttcattagccagaccggggactttattaagacgcaagagttttctcaaacaccgtct
gccgatgaaaaactcatgacaaacgcgacgattgttgaagagcaaaaaatccgtccgagc
gatatttatgaagaaaaggcggttgttttccctgttcttcatggcccaatgggagaagac
ggatctattcaaggcttcttggaagtgcttcgtatgccttatgttggcactaatatcttg
tcttcaagcgttgctatggacaaaatcactaccaagcgcgtacttgaatcagcaggaatc
tcccaggtaccttatgtggcagttatcgagggtgaaaatatcgacgataagattgcagag
attgaaggaaaattgacttatccggtctttgtaaaaccagctaatatggggtcaagtgtc
ggtatctcaaaagctgaggatttagctggcttgcgtaaggcacttgatctggccttcaag
tatgatagccgtgtcctcgttgagcagggtgttaatgcgcgtgagattgaggtcggtctt
ttgggaaatgctgacgtgaaaacgacacttcctggcgaagtagtcaaagacgttgctttt
tatgactacgatgccaaatacatcgacaacaaaatcaccatggaaatcccagctaagatt
gatgagtctatcatggatatcatgcgtgataatgctgccaaggccttccgtgctatcggt
ggttgtggactttctcgctgtgatttcttcctgactgaagacggcgacatcttcctaaac
gaactcaataccatgccaggtttcacccaatggtctatgtatccactcctttgggataat
atgggcctagcttatccagacttgattgaagagcttgttcgtttggctaaggaaatgttt
gaaaaacgcgaaagtcacctcatttaa

DBGET integrated database retrieval system