KEGG   Streptococcus suis BM407 (serotype 2): SSUBM407_1385Help
Entry
SSUBM407_1385     CDS       T00935                                 

Definition
(RefSeq) 6-phospho-beta-glucosidase
  KO
K01223  6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
ssb  Streptococcus suis BM407 (serotype 2)
Pathway
ssb00010  Glycolysis / Gluconeogenesis
ssb00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:ssb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SSUBM407_1385
   00500 Starch and sucrose metabolism
    SSUBM407_1385
Enzymes [BR:ssb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     SSUBM407_1385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_1 Cellulase
Motif
Other DBs
NCBI-GeneID: 8155208
NCBI-ProteinID: YP_003029089
UniProt: A0A0H3N0M6
LinkDB All DBs
Position
complement(1477640..1479064)
Genome map
AA seq 474 aa AA seqDB search
MSIFPDNFLWGGAVAANQVEGAYNEGGKGLSVQDVLPNGGLGEATQEPTEDNLKLQAIDF
YHRYKEDIALFSELGFKVFRTSIAWSRIFPNGDEEFPNEEGLQFYDELFDELLKNGIEPL
VTLSHYETPLYLARKYHGWVDRKMIQFFEKFARTVFERYKDKVKYWLTFNEVNSVLELPF
TSGGIDLPNEELSKQDLYQAIHHELVASSLVTKIAHEIIPDCKVGCMVLAMPTYPMTPNP
EDVWAAHAYENLNYLFSDIHVRGYYPNYAKRYFKENGIKITFVEGDEELLKNNTVDFLSF
SYYMSITQAADPSKYSSGKGNILGGLVNPYLEASDWGWQIDPIGLRLTLNRYYNRYQIPL
FIVENGLGAKDQLVKDEAGGLTVHDDYRIQYMQEHLLQVAEAIQDGVEVMGYTSWGCIDC
VSMSTAQLSKRYGLIYVDRNDDGSGSLTRYRKKSFYWYKEVIQSNGSILSNSSK
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgtcaatttttccagataatttcttatggggaggagcagtagctgcaaaccaagtagaa
ggtgcatataatgagggaggaaaaggattatccgttcaagatgttctccccaatggtgga
ctgggtgaagctacccaagaaccaacggaggataatttgaaattacaagctattgatttt
taccatcgatacaaggaagatatagccctgttttcagagttgggatttaaggtatttaga
acatcaattgcttggagtagaatatttccgaatggagatgaagaatttccaaatgaagaa
gggctacagttttatgatgaactttttgatgaacttctaaagaatggtatagagcctctt
gtaactctttctcactatgaaactcccctgtatctggcaaggaaatatcatggctgggtg
gatagaaaaatgattcaattttttgaaaaatttgctcgtacagtttttgagcgatacaaa
gataaggttaagtactggttgacatttaacgaggtcaattctgtcttagaattgcctttt
acaagtggtggaattgacttgccgaatgaagaactttcaaaacaagatttatatcaggcc
attcaccatgaacttgtagcttctagtcttgttaccaaaattgctcatgaaattattcct
gactgtaaggttggctgtatggtcttagctatgccgacctatccaatgacacccaatcct
gaagatgtttgggcggctcatgcctatgaaaatttgaactatttattttcggatatacat
gttagaggatattatcctaattatgccaaaagatactttaaagaaaatggcataaagatt
actttcgtggaaggtgatgaagagttattaaaaaataatacggttgattttctctccttc
agttattatatgagtattactcaggcagcagatccatcaaaatattcatctggaaaagga
aatatcttgggtggtttggtcaatccttatttagaagcttctgattggggttggcagatt
gatccaattggtttaagattgacactaaatcgttattataatcgataccagattccttta
ttcattgttgaaaatggtttgggagctaaagatcagctagtcaaggatgaggctggtggt
ttgactgttcatgacgattatcgaattcaatacatgcaagaacaccttttacaagttgcg
gaggcgatacaggatggcgtagaagtcatgggttatacttcttggggctgtattgattgt
gtatctatgtctaccgcacaattatctaaaagatatggactaatttatgttgatagaaat
gatgatggaagtggcagtctaactagatatagaaagaaatcattttactggtataaagaa
gttattcaatccaatggcagtatcctgagcaatagctcaaaatag

DBGET integrated database retrieval system