KEGG   Streptococcus suis BM407 (serotype 2): SSUBM407_1433Help
Entry
SSUBM407_1433     CDS       T00935                                 

Gene name
sodA
Definition
(RefSeq) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
ssb  Streptococcus suis BM407 (serotype 2)
Brite
Enzymes [BR:ssb01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     SSUBM407_1433 (sodA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N TGF_beta_GS
Motif
Other DBs
NCBI-GeneID: 8155249
NCBI-ProteinID: YP_003029137
UniProt: A0A0H3MX04
LinkDB All DBs
Position
complement(1521292..1521897)
Genome map
AA seq 201 aa AA seqDB search
MTIILPDLPYAYDALEPHIDAETMTLHHDKHHATYVANANAALEKHPEIGEDLVALLSDV
EQIPSDIRQALINNGGGHLNHALFWELLSPEKTEISAELAADIDATFGSFDAFKEAFTAA
ATTRFGSGWAFLVVNKEGKLEVISTANQDTPIMQGLKPILALDVWEHAYYLNYRNVRPNY
IKAFFEVINWDKVNELYKAAK
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgacaattattttaccagaccttccatacgcatacgatgccttggaaccacatattgat
gcagaaacaatgacccttcaccacgataagcaccatgcgacttatgttgcaaatgctaat
gcagcacttgaaaaacatcctgaaattggcgaagacttggtagctcttttgtcagatgtg
gagcaaattccttcagacatccgccaagctttgatcaacaacggtggtggtcatttgaac
catgctcttttctgggaattgctttcacctgaaaaaacagaaatttcagcagaattggca
gcagatattgatgcaacctttggttcatttgatgctttcaaagaagccttcactgcagca
gcaacaactcgtttcggttcaggttgggctttcttggttgttaataaagaaggcaagttg
gaagttatctcaactgctaaccaagacacaccaatcatgcaaggtttgaaaccaatcttg
gcattggacgtttgggaacatgcttactaccttaactaccgcaatgtccgtccaaactac
atcaaagccttctttgaagtaatcaactgggacaaggttaacgaactttataaagcagct
aaataa

DBGET integrated database retrieval system