KEGG   Sus scrofa (pig): 100037938
Entry
100037938         CDS       T01009                                 

Gene name
CD14
Definition
(RefSeq) monocyte differentiation antigen CD14 precursor
  KO
K04391  monocyte differentiation antigen CD14
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04010  MAPK signaling pathway
ssc04064  NF-kappa B signaling pathway
ssc04145  Phagosome
ssc04620  Toll-like receptor signaling pathway
ssc04640  Hematopoietic cell lineage
ssc05132  Salmonella infection
ssc05133  Pertussis
ssc05134  Legionellosis
ssc05146  Amoebiasis
ssc05152  Tuberculosis
ssc05202  Transcriptional misregulation in cancer
ssc05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100037938 (CD14)
   04064 NF-kappa B signaling pathway
    100037938 (CD14)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100037938 (CD14)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100037938 (CD14)
   04620 Toll-like receptor signaling pathway
    100037938 (CD14)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    100037938 (CD14)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    100037938 (CD14)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100037938 (CD14)
   05133 Pertussis
    100037938 (CD14)
   05134 Legionellosis
    100037938 (CD14)
   05152 Tuberculosis
    100037938 (CD14)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100037938 (CD14)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ssc04147]
    100037938 (CD14)
   04090 CD molecules [BR:ssc04090]
    100037938 (CD14)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ssc00537]
    100037938 (CD14)
Exosome [BR:ssc04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   100037938 (CD14)
CD molecules [BR:ssc04090]
 Proteins
  100037938 (CD14)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ssc00537]
 Receptors
  100037938 (CD14)
SSDB
Motif
Pfam: LRR_4 LRR_8 LRR_6
Other DBs
NCBI-GeneID: 100037938
NCBI-ProteinID: NP_001090914
Ensembl: ENSSSCG00000014369
Vega: OTTSUSG00000000895
UniProt: A7BG66
LinkDB
Position
2
AA seq 373 aa
MVRLPCPLLLLLPLLRVSAATPEPCQIDDEDVRCVCNFTHPQPDWSSALQCVAAVEVEIR
GGGRSLDEFLLKSASANPKQYADMLKALRLRRLTVGAARVPAQILALVLHALGFSRLKEL
TLEDLEVTGQVPPPLQETPGPALTTLRLRNVSWATGGAWLGELQQWLQPSLKVLKVAQAS
SLAFPCAQLRAFPALTTLDLSDNPGLGERGLTAALCPRKFPALEDLALRNAGVETPSGVC
AALAGAGVQPHRLDLSHNSLRATAAGARECVWPAALSSLNLSFAELEQVPKGLPPKLTVL
DLSCNKLNRAPRPEELPAVDDLTLEGNPYMDPEALQHQEDPMASGVVPPCARSALTMGVS
GTLALLQGARGFA
NT seq 1122 nt   +upstreamnt  +downstreamnt
atggtgcgcttgccctgcccgttgctgctgctgctgcccctgctgcgtgtgtctgcggcc
accccggagccctgccaaatagacgacgaagacgtccgctgcgtctgcaacttcacgcat
ccgcagccggactggtccagcgccctgcagtgcgtggctgccgtcgaggtggagatccgc
ggcggcggccggagcctggatgagttccttttaaagagcgccagcgccaacccgaagcag
tacgcggacatgctcaaggcgctgcgcttgcggcgactcacggtgggcgctgcgcgggtt
cctgctcagattctggccctggtcctgcatgcgctcgggttctcccgcctcaaggaactg
acgctcgaggacctggaggtaaccggccaggtaccgccgccgcttcaggaaacgccggga
cctgcgctcaccaccctcagactccgtaatgtgtcgtgggccaccggaggtgcctggctc
ggcgaactgcagcagtggctccagccaagcctcaaggtactgaaagtggcgcaagcaagc
tcgcttgcctttccgtgcgcccagcttcgcgccttcccggctctcaccaccctggaccta
tctgacaatcccgggctgggcgagcgcgggctgactgcagctctctgtccgcgcaagttc
ccggccctcgaggatctggcgctgcgcaacgcgggggtggagacacccagcggcgtgtgc
gcggcgctggcgggggcgggcgtgcaaccccaccgcctggacctcagtcacaactcgctg
cgcgccaccgccgcgggcgcccgggagtgtgtctggcctgccgccctgagctctctcaat
ttgtcattcgctgagctggagcaagtgcctaaaggactgccgcccaagctcaccgtgctt
gatctcagctgcaacaagctgaacagagcgccgcggccagaggagctgcccgccgtggat
gacctgaccctggaagggaatccctatatggatcctgaagccctccagcaccaggaagac
ccgatggcctctggcgtggtcccaccctgtgcgcgttccgccttgaccatgggggtgtcg
ggaaccctggcgctgcttcagggagcccggggcttcgcctaa

DBGET integrated database retrieval system