KEGG   Sus scrofa (pig): 100037955Help
Entry
100037955         CDS       T01009                                 

Gene name
C8G
Definition
(RefSeq) complement component C8 gamma chain precursor
  KO
K03999  complement component 8 subunit gamma
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04610  Complement and coagulation cascades
ssc05020  Prion diseases
ssc05146  Amoebiasis
ssc05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    100037955 (C8G)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    100037955 (C8G)
  09164 Neurodegenerative disease
   05020 Prion diseases
    100037955 (C8G)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100037955 (C8G)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lipocalin
Motif
Other DBs
NCBI-GeneID: 100037955
NCBI-ProteinID: NP_001090921
Ensembl: ENSSSCG00000005840
UniProt: A0SEH3
LinkDB All DBs
AA seq 202 aa AA seqDB search
MLVPRAAPLLTLLLATGSLGQRAQRPPRRPSPISTIQPKASFDAQQFAGTWLLVAVASSC
RFLQEQGHRAEATSLHVAPQGAAMAVSTFRKLDGICWQVRQLFRDTGLPGRFLLQARGAR
GAVDVVVGETDYRSFAILYLERARQLSVKLYARSLPVSESALSVFEQRVQGANLTEDHIL
FFPKYGFCDAADQFHVLDEAKQ
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgctagtccccagggctgcacccctcttgacgctgctcctggccacgggctccttgggc
cagagggctcagagaccccctcgacgcccatcccccatcagcaccatccagcccaaggcc
agctttgatgcccagcagtttgcagggacgtggctcctggtggccgtggcttcctcctgc
cgcttcctgcaagagcagggccaccgggctgaggccacttcactgcacgtggctcctcag
ggtgcagccatggccgtcagcaccttccgaaagctggatgggatctgctggcaggtgcgg
cagctcttcagagacacggggctcccaggtcgcttcctgctccaggcccgaggcgcccga
ggcgcggtggatgtggtcgttggggagacggactaccggagctttgccatcctgtacctg
gagagggcccggcagctgtcggtgaagctgtacgcccgctcgctccccgtgagcgaatca
gccctgagtgtctttgagcagcgggtccagggggccaacctgaccgaggaccacatcctg
ttcttccccaagtacggcttctgcgacgctgcagaccagttccacgtcctggacgaagca
aagcagtga

DBGET integrated database retrieval system