KEGG   Sus scrofa (pig): 100038019
Entry
100038019         CDS       T01009                                 

Gene name
TGFBR2
Definition
(RefSeq) TGF-beta receptor type-2
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04010  MAPK signaling pathway
ssc04060  Cytokine-cytokine receptor interaction
ssc04068  FoxO signaling pathway
ssc04144  Endocytosis
ssc04218  Cellular senescence
ssc04350  TGF-beta signaling pathway
ssc04380  Osteoclast differentiation
ssc04390  Hippo signaling pathway
ssc04520  Adherens junction
ssc04659  Th17 cell differentiation
ssc04926  Relaxin signaling pathway
ssc04933  AGE-RAGE signaling pathway in diabetic complications
ssc05142  Chagas disease
ssc05161  Hepatitis B
ssc05166  Human T-cell leukemia virus 1 infection
ssc05200  Pathways in cancer
ssc05202  Transcriptional misregulation in cancer
ssc05210  Colorectal cancer
ssc05212  Pancreatic cancer
ssc05220  Chronic myeloid leukemia
ssc05225  Hepatocellular carcinoma
ssc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100038019 (TGFBR2)
   04350 TGF-beta signaling pathway
    100038019 (TGFBR2)
   04390 Hippo signaling pathway
    100038019 (TGFBR2)
   04068 FoxO signaling pathway
    100038019 (TGFBR2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100038019 (TGFBR2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100038019 (TGFBR2)
  09143 Cell growth and death
   04218 Cellular senescence
    100038019 (TGFBR2)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    100038019 (TGFBR2)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    100038019 (TGFBR2)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    100038019 (TGFBR2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100038019 (TGFBR2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100038019 (TGFBR2)
   05202 Transcriptional misregulation in cancer
    100038019 (TGFBR2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100038019 (TGFBR2)
   05212 Pancreatic cancer
    100038019 (TGFBR2)
   05225 Hepatocellular carcinoma
    100038019 (TGFBR2)
   05226 Gastric cancer
    100038019 (TGFBR2)
   05220 Chronic myeloid leukemia
    100038019 (TGFBR2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100038019 (TGFBR2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100038019 (TGFBR2)
   05161 Hepatitis B
    100038019 (TGFBR2)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    100038019 (TGFBR2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ssc01001]
    100038019 (TGFBR2)
Enzymes [BR:ssc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     100038019 (TGFBR2)
Protein kinases [BR:ssc01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   100038019 (TGFBR2)
SSDB
Motif
Pfam: ecTbetaR2 PK_Tyr_Ser-Thr Pkinase Pkinase_fungal APH
Other DBs
NCBI-GeneID: 100038019
NCBI-ProteinID: XP_020927152
LinkDB
Position
13
AA seq 567 aa
MGRGLLGGLWPLHVVLWTRIASTIPPHVPKSVNSDMMVTDSNGAVKLPQLCKFCDVRSST
CDNQKSCLSNCSITAICEKPQEVCVAVWRKNDENITIETVCHDPKIAYHGFVLDDAASSK
CIMKERKGSGETFFMCSCSSDECNDHIIFSEEYATNNPDLLLVIFQVTGVSLLPPLGIAI
AVIITFYCYRVHRQQKLSPSWDSGKPRKLMEFSEHLAIILEDDRSDISSTCANNINHNTE
LLPIELDTLVGKGRFAEVYKAKLRQNTSEQFETVAVKIFPYEEYASWKTEKDIFSDINLK
HENILQFLTAEERKTELGKQYWLITAFHAKGNLQEYLTRHVISWEDLRRLGGSLARGIAH
LHSDHTLCGRPKMPIVHRDLKSSNILVKGDLTCCLCDFGLSLRLDPTLSVDDLANSGQVG
TARYMAPEVLESRMNLENVESFKQTDVYSMALVLWEMTSRCNAVGEVKDYEPPFGSKVRE
HPCVESMKDNVLRDRGRPEIPSSWLNHQGIQTVCETLAECWDHDPEARLTAQCVAERFSE
LEHLDRLSGRSSSEEKIPEHGSLNTTK
NT seq 1704 nt   +upstreamnt  +downstreamnt
atgggccgggggctgctcgggggcctgtggccgctgcacgtcgtcctgtggacgcgcatc
gccagcacgatcccgccgcacgttcccaagtcggttaatagcgacatgatggtcactgac
agcaatggtgccgtcaagcttccacaactgtgtaaattctgtgatgtgcgatcatccacc
tgtgacaaccagaagtcctgcctgagcaactgcagcatcacagccatctgtgagaagcca
caggaggtctgcgtggctgtctggaggaagaatgacgagaacatcacaattgagacagtt
tgtcacgaccccaagatcgcctaccacggatttgttctcgatgacgccgcttcttcaaaa
tgtattatgaaggagaggaaagggtctggagagacgttctttatgtgctcctgcagctca
gacgagtgcaacgaccacatcatcttctcagaagagtatgccaccaacaaccccgacttg
ctgttagtcatcttccaagtgacaggtgtcagcctcctgccaccactaggcatcgccatc
gccgtcatcatcaccttctactgctaccgtgtccaccggcagcagaagctgagcccatcc
tgggactcagggaagccgcggaagctgatggagttcagtgagcacctggccatcatcctg
gaggatgaccgctccgacatcagctccacctgtgccaacaacatcaaccacaacacggaa
ctgctgcccatcgagctggacaccctggtgggcaaagggcgctttgccgaggtctataag
gccaagctgaggcagaacacatctgagcagttcgagaccgtggctgtcaagatcttcccc
tatgaggagtatgcctcctggaagacagagaaggacatcttctcggacatcaacctcaag
cacgagaacatcctgcagttcctgacagctgaggaacgcaagacagagctgggcaagcag
tactggctgatcactgccttccacgccaagggcaacctgcaggagtatctgacgcgccac
gtcatcagctgggaggacctccgcaggctgggcggctcgctggcccgtggcattgcacac
ctgcacagcgaccacaccctgtgcggccggcccaagatgcccatcgtgcacagggacctc
aagagctccaacatcctggtcaaaggtgacctcacctgctgcctctgtgacttcggcctc
tccctgcggctggaccccactctgtcagtggatgacttggccaacagtgggcaggtggga
actgcaagatacatggctcctgaagtcctagagtccaggatgaatttggagaatgttgag
tccttcaagcagacggatgtctactccatggctctggtgctctgggagatgacgtctcgc
tgcaacgcggtgggagaggtgaaggactatgagccaccctttggttccaaggtgcgggag
catccctgtgttgaaagcatgaaggacaacgtgttgagagaccgaggacggccagaaatt
cctagctcctggctcaaccaccagggcatccagacagtgtgtgagacactggccgagtgc
tgggaccatgaccccgaggcccggctcactgcgcagtgcgtggcagagcgcttcagcgag
ctggagcatctggacagactctcggggaggagcagctcggaagagaagattcctgaacat
ggctccctgaacactaccaaatag

DBGET integrated database retrieval system