KEGG   Sus scrofa (pig): 100048953
Entry
100048953         CDS       T01009                                 

Gene name
CDH1
Definition
(RefSeq) cadherin-1 precursor
  KO
K05689  cadherin 1, type 1, E-cadherin
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04015  Rap1 signaling pathway
ssc04371  Apelin signaling pathway
ssc04390  Hippo signaling pathway
ssc04514  Cell adhesion molecules
ssc04520  Adherens junction
ssc05100  Bacterial invasion of epithelial cells
ssc05200  Pathways in cancer
ssc05213  Endometrial cancer
ssc05216  Thyroid cancer
ssc05218  Melanoma
ssc05219  Bladder cancer
ssc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100048953 (CDH1)
   04390 Hippo signaling pathway
    100048953 (CDH1)
   04371 Apelin signaling pathway
    100048953 (CDH1)
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100048953 (CDH1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    100048953 (CDH1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100048953 (CDH1)
  09162 Cancer: specific types
   05226 Gastric cancer
    100048953 (CDH1)
   05216 Thyroid cancer
    100048953 (CDH1)
   05218 Melanoma
    100048953 (CDH1)
   05219 Bladder cancer
    100048953 (CDH1)
   05213 Endometrial cancer
    100048953 (CDH1)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    100048953 (CDH1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ssc03036]
    100048953 (CDH1)
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:ssc04515]
    100048953 (CDH1)
   04090 CD molecules [BR:ssc04090]
    100048953 (CDH1)
Chromosome and associated proteins [BR:ssc03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    100048953 (CDH1)
Cell adhesion molecules [BR:ssc04515]
 Cadherins
  Major cadherins
   100048953 (CDH1)
CD molecules [BR:ssc04090]
 Proteins
  100048953 (CDH1)
SSDB
Motif
Pfam: Cadherin Cadherin_C Cadherin_pro RET_CLD1 RibLong Tic22
Other DBs
NCBI-GeneID: 100048953
NCBI-ProteinID: NP_001156532
Ensembl: ENSSSCG00000025652
UniProt: C6EVT4
LinkDB
Position
6
AA seq 883 aa
MGPPCRSLSALLLLLQVSSWLCQEPEPCNPGFGAKSYTFTVPRRHLERGRVLGRVSFEGC
TGLPRTVYVSDDTRFKVGTDGVVTVKRPFQLHNPEISFLIHAWDSTRRKLSTKVTLKAAT
HHHHHHRHQDSPSGAHTEVLTFPSSHHGLRRQKRDWVIPPISCPENEKGPFPKDLVQIKS
NREKETKVFYSITGQGADTPPVGVFMIERETGWLKVTEPLDREAIAKYILYSHAVSSNGQ
AIEEPMEIVITVTDQNDNKPEFTQEVFRGSVMEGALPGTSVMQVTATDKDDDVNTYNAAI
AYTILSQEPTLPHNQMFTINSDTGVISVLTTGLDRESFPTYTLVIQAADLQGDGLSTTAT
AMITVTDINDNPPIFNPTSYQGSVPENEANVAITTLTVTDGDVANTPAWVAVYTILNDNE
KQFVVITDPVTNEGVLKTAKGLDFEAKQQYILYVAVTNVAPFEVTLSTSTATVTVDVIDV
NEAPIFIPAQKRVEVPEDFGVGLEITSYTAREPDTFMEQKITYRIWRDAANWLEINPDTG
AITTRAELDRENFEHVKNSTYTALIIATDNGSPPATGTGTLLLFLDDVNDNGPIPEPRNM
DFCQRNPQPHVININDPDLPPNTSPFTAELTHGASANWTIEFNDREHESLILKPKKTLEF
GDYKINLKLTDNQNKDQVTTLDVHVCDCEGVANSCRKAGPLAEAGLQVPAILGILGGILA
FLILILLLLLLIRRRRVVKEPLLPPEDDTRDNVYYYDEEGGGEEDQDFDLSQLHRGLDAR
PEVTRNDVAPTLLSVPQYRPRPANPDEIGNFIDENLKAADSDPTAPPYDSLLVFDYEGSG
SEAASLSSLNSSESDQDQDYDYLNEWGNRFKKLADMYGGGEDD
NT seq 2652 nt   +upstreamnt  +downstreamnt
atgggccctccgtgccgcagtctctctgctctcctgctgctgttgcaggtctcatcgtgg
ctctgccaagagccggagccctgcaatcctggctttggcgccaagagctacacgttcacc
gtgccccggcggcacttggagagaggccgagtcctgggccgagtgagttttgaaggatgc
accggtctgccaaggacggtctatgtttctgatgacacccgattcaaagtgggcaccgac
ggtgtggttacagtcaaacggccatttcagcttcataacccggagattagttttctcatc
cacgcctgggactccacccgcaggaagctgtccaccaaggtgacactgaaggcggccaca
caccaccatcaccaccaccgccatcaggactctccctctggcgcccacacagaagtgctc
acgtttcccagctcccaccatggtctcagaagacagaaaagagactgggttatccctccc
atcagctgcccagaaaatgagaaaggcccgtttcctaaggatctggttcagatcaaatct
aacagagaaaaagaaaccaaggttttctacagcatcactggtcaaggagccgacacacct
cccgtcggtgtgtttatgattgaaagagaaacagggtggctgaaggtgacggagcctctg
gatagagaagccattgccaagtacattctctactctcatgccgtgtcttccaacgggcaa
gccatcgaggagcccatggagattgtgatcaccgtgaccgatcagaacgacaacaagccc
gagttcacccaggaggtcttcaggggctccgtcatggagggcgctcttccagggacctct
gtgatgcaggtcacggccacggacaaagacgacgatgtgaacacctacaatgctgccatt
gcttacaccatcctcagccaggagcctaccctgcctcacaaccaaatgttcaccatcaac
agtgacacaggagtcatcagtgtgctcaccactgggctggaccgggagagttttcccacg
tacaccctggtgattcaggctgcagaccttcaaggtgacggcttaagcacgactgcaaca
gccatgatcacggtcactgacatcaacgacaacccacccatcttcaacccaacctcgtac
caggggtcggtgccggagaacgaggccaacgtggcaatcaccacactcacggtgaccgat
ggtgacgtcgccaataccccggcgtgggtggctgtttacacaatattaaatgacaacgag
aagcaatttgttgtcatcacagacccagtaaccaatgaaggcgttttgaaaacagctaag
ggcttggattttgaagccaagcagcagtacatcctgtatgtggcagtgactaacgtggcc
ccctttgaggtcaccctctctacttccacggccactgtcactgtggacgtgatagatgtg
aatgaggcccccatcttcatccctgctcagaagagggtggaagtgcctgaggatttcggc
gtgggcctggagatcacatcctacactgcccgggagccagacacgtttatggaacagaag
atcacgtatcggatttggagggatgctgccaactggctggagattaatccggacaccggt
gccattaccactcgggccgagctggacagagagaactttgagcatgtgaagaacagcaca
tacacggccctcattatagccactgacaatggttctccacccgctacgggcacaggcacc
cttctcctgttcctcgacgatgtgaatgacaatggccccatacctgaaccccgaaatatg
gacttctgccagaggaacccacagcctcatgtcatcaacatcaatgatccagatcttccc
cccaacacttctcccttcactgcagaactaacacatggggccagtgccaactggaccatc
gagttcaacgaccgagaacatgaatctctcattttgaagccaaagaaaaccctcgagttt
ggcgactacaagatcaatctcaagctcacagacaaccagaacaaagaccaggtgaccacc
ttagatgtgcacgtatgcgactgtgagggggtggccaacagctgccggaaggccgggcct
ctggccgaagcaggattgcaagttcctgccatcctggggattctgggaggcatccttgct
tttctgatcctgattctgctgctcctgctccttattcggaggagaagggtggtcaaagag
cccttgctgcccccagaagatgacacccgggacaacgtttattactatgatgaagaagga
ggtggagaagaggaccaggactttgacttgagccagttacacaggggcctggatgctcgg
cctgaagtgactcgtaatgatgtggcaccaaccctcctgagtgtgccccagtatcggccc
cgccctgccaatcctgatgaaattggaaactttattgatgaaaacctgaaggcagctgat
agtgaccccactgccccaccttatgactctctgctggtgtttgattacgaaggcagtggt
tccgaagctgctagtctgagctccctgaactcctcggagtcggaccaagaccaggactat
gactacctgaacgagtggggcaatcgcttcaagaagctggcggacatgtacggaggcggt
gaggacgactag

DBGET integrated database retrieval system