KEGG   Sus scrofa (pig): 100101471
Entry
100101471         CDS       T01009                                 

Gene name
IKBKB
Definition
(RefSeq) inhibitor of nuclear factor kappa-B kinase subunit beta
  KO
K07209  inhibitor of nuclear factor kappa-B kinase subunit beta [EC:2.7.11.10]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc01523  Antifolate resistance
ssc04010  MAPK signaling pathway
ssc04014  Ras signaling pathway
ssc04062  Chemokine signaling pathway
ssc04064  NF-kappa B signaling pathway
ssc04068  FoxO signaling pathway
ssc04150  mTOR signaling pathway
ssc04151  PI3K-Akt signaling pathway
ssc04210  Apoptosis
ssc04380  Osteoclast differentiation
ssc04620  Toll-like receptor signaling pathway
ssc04621  NOD-like receptor signaling pathway
ssc04622  RIG-I-like receptor signaling pathway
ssc04623  Cytosolic DNA-sensing pathway
ssc04625  C-type lectin receptor signaling pathway
ssc04657  IL-17 signaling pathway
ssc04658  Th1 and Th2 cell differentiation
ssc04659  Th17 cell differentiation
ssc04660  T cell receptor signaling pathway
ssc04662  B cell receptor signaling pathway
ssc04668  TNF signaling pathway
ssc04722  Neurotrophin signaling pathway
ssc04910  Insulin signaling pathway
ssc04920  Adipocytokine signaling pathway
ssc04930  Type II diabetes mellitus
ssc04931  Insulin resistance
ssc04932  Non-alcoholic fatty liver disease
ssc05010  Alzheimer disease
ssc05132  Salmonella infection
ssc05135  Yersinia infection
ssc05142  Chagas disease
ssc05145  Toxoplasmosis
ssc05160  Hepatitis C
ssc05161  Hepatitis B
ssc05162  Measles
ssc05163  Human cytomegalovirus infection
ssc05164  Influenza A
ssc05165  Human papillomavirus infection
ssc05166  Human T-cell leukemia virus 1 infection
ssc05167  Kaposi sarcoma-associated herpesvirus infection
ssc05168  Herpes simplex virus 1 infection
ssc05169  Epstein-Barr virus infection
ssc05170  Human immunodeficiency virus 1 infection
ssc05171  Coronavirus disease - COVID-19
ssc05200  Pathways in cancer
ssc05206  MicroRNAs in cancer
ssc05212  Pancreatic cancer
ssc05215  Prostate cancer
ssc05220  Chronic myeloid leukemia
ssc05221  Acute myeloid leukemia
ssc05222  Small cell lung cancer
ssc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ssc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100101471 (IKBKB)
   04014 Ras signaling pathway
    100101471 (IKBKB)
   04064 NF-kappa B signaling pathway
    100101471 (IKBKB)
   04668 TNF signaling pathway
    100101471 (IKBKB)
   04068 FoxO signaling pathway
    100101471 (IKBKB)
   04151 PI3K-Akt signaling pathway
    100101471 (IKBKB)
   04150 mTOR signaling pathway
    100101471 (IKBKB)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100101471 (IKBKB)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100101471 (IKBKB)
   04621 NOD-like receptor signaling pathway
    100101471 (IKBKB)
   04622 RIG-I-like receptor signaling pathway
    100101471 (IKBKB)
   04623 Cytosolic DNA-sensing pathway
    100101471 (IKBKB)
   04625 C-type lectin receptor signaling pathway
    100101471 (IKBKB)
   04660 T cell receptor signaling pathway
    100101471 (IKBKB)
   04658 Th1 and Th2 cell differentiation
    100101471 (IKBKB)
   04659 Th17 cell differentiation
    100101471 (IKBKB)
   04657 IL-17 signaling pathway
    100101471 (IKBKB)
   04662 B cell receptor signaling pathway
    100101471 (IKBKB)
   04062 Chemokine signaling pathway
    100101471 (IKBKB)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100101471 (IKBKB)
   04920 Adipocytokine signaling pathway
    100101471 (IKBKB)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100101471 (IKBKB)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100101471 (IKBKB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100101471 (IKBKB)
   05206 MicroRNAs in cancer
    100101471 (IKBKB)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100101471 (IKBKB)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100101471 (IKBKB)
   05221 Acute myeloid leukemia
    100101471 (IKBKB)
   05220 Chronic myeloid leukemia
    100101471 (IKBKB)
   05215 Prostate cancer
    100101471 (IKBKB)
   05222 Small cell lung cancer
    100101471 (IKBKB)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100101471 (IKBKB)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100101471 (IKBKB)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100101471 (IKBKB)
   04932 Non-alcoholic fatty liver disease
    100101471 (IKBKB)
   04931 Insulin resistance
    100101471 (IKBKB)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100101471 (IKBKB)
   05135 Yersinia infection
    100101471 (IKBKB)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100101471 (IKBKB)
   05170 Human immunodeficiency virus 1 infection
    100101471 (IKBKB)
   05161 Hepatitis B
    100101471 (IKBKB)
   05160 Hepatitis C
    100101471 (IKBKB)
   05171 Coronavirus disease - COVID-19
    100101471 (IKBKB)
   05164 Influenza A
    100101471 (IKBKB)
   05162 Measles
    100101471 (IKBKB)
   05168 Herpes simplex virus 1 infection
    100101471 (IKBKB)
   05163 Human cytomegalovirus infection
    100101471 (IKBKB)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100101471 (IKBKB)
   05169 Epstein-Barr virus infection
    100101471 (IKBKB)
   05165 Human papillomavirus infection
    100101471 (IKBKB)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100101471 (IKBKB)
   05142 Chagas disease
    100101471 (IKBKB)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    100101471 (IKBKB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ssc01001]
    100101471 (IKBKB)
Enzymes [BR:ssc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.10  IkappaB kinase
     100101471 (IKBKB)
Protein kinases [BR:ssc01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   100101471 (IKBKB)
SSDB
Motif
Pfam: IKBKB_SDD Pkinase PK_Tyr_Ser-Thr IKKbetaNEMObind Pkinase_fungal Kdo APH YrbL-PhoP_reg ubiquitin Glyco_hydro_65m Med20
Other DBs
NCBI-GeneID: 100101471
NCBI-ProteinID: NP_001093405
Ensembl: ENSSSCG00000007030
Vega: OTTSUSG00000001517
UniProt: A5A757 A0A4X1UAT1
LinkDB
Position
17
AA seq 755 aa
MSWSPSLTTQTCGAWEMKERLGTGGFGNVIRWHNQETGEQIAIKQCRQELSPRNRERWCL
EIQIMRRLNHPNVVAARDVPEGMQNLAPNDLPLLAMEYCQGGDLRKYLNQFENCCGLREG
AILTLLSDIASALRYLHENRIIHRDLKPENIVLQQGEQRLIHKIIDLGYAKELDQGSLCT
SFVGTLQYLAPELLEQQKYTVTVDYWSFGTLAFECITGFRPFLPNWQPVQWHSKVRQKSE
MDIVVSEDLNGTVKFSSSLPYPNNLNSVLAQRLEKWLQLMLMWHPRQRGTDPTYGPNGCF
KALDDILTLKLVHILNMVTGTIHTYPVTEDESLQSLKARIRQDTGILEEAQELLQEAGLA
LIPDKPAAQCISDGKLNEGRTLDMDLVFLFDNSRVTYDTQISPRPQPESVSCILQEPKRN
LPFFQLRKVWGQVWHSIQALKEDCSRLQQGQRAAMMNLLRNNSCLSKMKNSMASMSQQLK
AKLDFFKTSIQIDLEKYSEQTEFGITSDKLLLAWREMEQAVELCGRENEVKHLVERMMAL
QTDIVDLQRSPMGRKQGGTLDDLEEQARELYRRLREKPRDQRTDGDSQEMVRLLLQAIQG
FEKKVRVIYTQLSKTVVCKQKALELLPRVEEVVSLMNEDEKTVVRLQEKRQKELWNLLKI
ACSKVRGPVSGSPDSMNASRLSHPSQLMSQPCPAPDSLPEAIKKSEDLVAEAHSLCAQLE
NVLQDTMKEQDQSLKSLDWSWLQVEEEQNSLEQAS
NT seq 2268 nt   +upstreamnt  +downstreamnt
atgagctggtcaccttccctgacaacccaaacatgtggggcctgggaaatgaaagaacgg
cttgggacagggggatttgggaacgtcatccgatggcacaatcaggaaacgggcgagcag
atcgctatcaagcagtgccggcaggagctcagtccccggaaccgtgagcgctggtgcctg
gagatccagatcatgaggaggctgaaccaccccaatgtggtggccgcccgggatgtccct
gaggggatgcagaacctggctcccaacgacttgccccttctggccatggagtactgccag
ggcggggatctgcgcaagtacttgaatcagttcgagaactgttgtggcctgcgggaagga
gccatcctcaccttgctgagtgacatcgcctctgcacttagataccttcacgaaaacaga
atcatccatcgggatctaaagccagaaaacatcgtcctgcagcaaggcgaacagagatta
atacacaaaattattgacctcgggtatgccaaggagctggaccagggcagcctctgtacc
tcctttgtggggaccctgcagtacctggccccggagctgctggagcagcagaagtacaca
gtgacagtygactactggagcttcggcaccttggcctttgagtgcatcaccggcttccgg
cccttcctgcccaactggcagccggtgcagtggcactccaaagtccggcagaagagcgag
atggacatcgtggtgagcgaggacctgaatggcaccgtgaagttctccagctcattaccc
taccccaacaacctcaacagtgtcctggcccagcggctggagaagtggctgcagctgatg
ctgatgtggcacccccggcagaggggcaccgatcccacgtacgggcccaatggctgcttc
aaggccctggatgacatcttaaccttgaagctggttcatatcttgaacatggtcacaggc
accattcatacctaccccgtgaccgaggacgagagcctgcagagcttgaaggcccggatc
cggcaggacacaggcatcctcgaggaggcccaggagctgctgcaggaggcgggtctggcg
ctgatccccgacaagcccgcggctcagtgcatctccgatggcaagctgaacgagggccgc
accctggacatggatctcgtcttcctctttgacaacagcagagtcacctatgacacccag
atctccccscggccccagcccgaaagcgtcagctgcatcctgcaagagcccaagcggaac
ctcccgtttttccagctgaggaaggtgtggggccaggtctggcacagcatccaggccctg
aaggaagactgcagccgcctgcagcagggacagcgtgctgccatgatgaatctgcttcgg
aacaacagctgcctgtccaagatgaagaactccatggcctccatgtcccagcagctcaag
gccaagcttgatttcttcaaaaccagcatccagattgacctggagaagtacagcgagcag
acagagtttgggatcacatcggacaaactgctgctggcctggagggagatggaacaggcc
gtggagctctgcggacgggagaacgaggtgaagcacctggtggagcggatgatggccctg
cagaccgacatcgtggacctgcagcgcagccccatgggccgcaagcagggcgggacgctg
gacgacctagaagagcaggcacgggaactttatcggagactgagggaaaagccccgagac
cagcggaccgatggcgacagtcaggaaatggtgcggctgctcctccaggccatccagggc
tttgagaagaaagtgcgagtgatttacacacagctcagtaagacggtggtttgcaagcag
aaggccctggagctgctgcccagggtggaggaggtagtgagtctcatgaacgaggacgag
aagaccgtggttcggcttcaggagaarcggcagaaggagctctggaacctcctgaagatc
gcttgtagcaaggtccgtggtcctgtcagcggaagcccggacagcatgaatgcctctcgc
ctgagtcaccccagccagctgatgtcgcagccctgccctgcccccgacagtttacctgag
gccatcaagaaaagtgaagacctcgtggctgaagcacacagcctgtgcgcccagctggaa
aatgtgctgcaggacacgatgaaggagcaggaccagagcttaaagtccctagactggagc
tggctgcaggtggaggaggagcagaacagcctggagcaggcctcgtga

KEGG   Sus scrofa (pig): 100127355
Entry
100127355         CDS       T01009                                 

Gene name
IKBKG
Definition
(RefSeq) NF-kappa-B essential modulator
  KO
K07210  inhibitor of nuclear factor kappa-B kinase subunit gamma
Organism
ssc  Sus scrofa (pig)
Pathway
ssc01523  Antifolate resistance
ssc04010  MAPK signaling pathway
ssc04014  Ras signaling pathway
ssc04062  Chemokine signaling pathway
ssc04064  NF-kappa B signaling pathway
ssc04151  PI3K-Akt signaling pathway
ssc04210  Apoptosis
ssc04380  Osteoclast differentiation
ssc04620  Toll-like receptor signaling pathway
ssc04621  NOD-like receptor signaling pathway
ssc04622  RIG-I-like receptor signaling pathway
ssc04623  Cytosolic DNA-sensing pathway
ssc04625  C-type lectin receptor signaling pathway
ssc04657  IL-17 signaling pathway
ssc04658  Th1 and Th2 cell differentiation
ssc04659  Th17 cell differentiation
ssc04660  T cell receptor signaling pathway
ssc04662  B cell receptor signaling pathway
ssc04668  TNF signaling pathway
ssc04920  Adipocytokine signaling pathway
ssc05132  Salmonella infection
ssc05135  Yersinia infection
ssc05142  Chagas disease
ssc05145  Toxoplasmosis
ssc05160  Hepatitis C
ssc05161  Hepatitis B
ssc05162  Measles
ssc05163  Human cytomegalovirus infection
ssc05164  Influenza A
ssc05165  Human papillomavirus infection
ssc05166  Human T-cell leukemia virus 1 infection
ssc05167  Kaposi sarcoma-associated herpesvirus infection
ssc05168  Herpes simplex virus 1 infection
ssc05169  Epstein-Barr virus infection
ssc05170  Human immunodeficiency virus 1 infection
ssc05171  Coronavirus disease - COVID-19
ssc05200  Pathways in cancer
ssc05203  Viral carcinogenesis
ssc05212  Pancreatic cancer
ssc05215  Prostate cancer
ssc05220  Chronic myeloid leukemia
ssc05221  Acute myeloid leukemia
ssc05222  Small cell lung cancer
ssc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ssc05340  Primary immunodeficiency
ssc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100127355 (IKBKG)
   04014 Ras signaling pathway
    100127355 (IKBKG)
   04064 NF-kappa B signaling pathway
    100127355 (IKBKG)
   04668 TNF signaling pathway
    100127355 (IKBKG)
   04151 PI3K-Akt signaling pathway
    100127355 (IKBKG)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100127355 (IKBKG)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100127355 (IKBKG)
   04621 NOD-like receptor signaling pathway
    100127355 (IKBKG)
   04622 RIG-I-like receptor signaling pathway
    100127355 (IKBKG)
   04623 Cytosolic DNA-sensing pathway
    100127355 (IKBKG)
   04625 C-type lectin receptor signaling pathway
    100127355 (IKBKG)
   04660 T cell receptor signaling pathway
    100127355 (IKBKG)
   04658 Th1 and Th2 cell differentiation
    100127355 (IKBKG)
   04659 Th17 cell differentiation
    100127355 (IKBKG)
   04657 IL-17 signaling pathway
    100127355 (IKBKG)
   04662 B cell receptor signaling pathway
    100127355 (IKBKG)
   04062 Chemokine signaling pathway
    100127355 (IKBKG)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100127355 (IKBKG)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100127355 (IKBKG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100127355 (IKBKG)
   05203 Viral carcinogenesis
    100127355 (IKBKG)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100127355 (IKBKG)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100127355 (IKBKG)
   05221 Acute myeloid leukemia
    100127355 (IKBKG)
   05220 Chronic myeloid leukemia
    100127355 (IKBKG)
   05215 Prostate cancer
    100127355 (IKBKG)
   05222 Small cell lung cancer
    100127355 (IKBKG)
  09163 Immune disease
   05340 Primary immunodeficiency
    100127355 (IKBKG)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100127355 (IKBKG)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100127355 (IKBKG)
   05135 Yersinia infection
    100127355 (IKBKG)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100127355 (IKBKG)
   05170 Human immunodeficiency virus 1 infection
    100127355 (IKBKG)
   05161 Hepatitis B
    100127355 (IKBKG)
   05160 Hepatitis C
    100127355 (IKBKG)
   05171 Coronavirus disease - COVID-19
    100127355 (IKBKG)
   05164 Influenza A
    100127355 (IKBKG)
   05162 Measles
    100127355 (IKBKG)
   05168 Herpes simplex virus 1 infection
    100127355 (IKBKG)
   05163 Human cytomegalovirus infection
    100127355 (IKBKG)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100127355 (IKBKG)
   05169 Epstein-Barr virus infection
    100127355 (IKBKG)
   05165 Human papillomavirus infection
    100127355 (IKBKG)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100127355 (IKBKG)
   05142 Chagas disease
    100127355 (IKBKG)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    100127355 (IKBKG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ssc01001]
    100127355 (IKBKG)
Protein kinases [BR:ssc01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   100127355 (IKBKG)
SSDB
Motif
Pfam: CC2-LZ NEMO zf_C2H2_10 zf_C2H2_ZHX
Other DBs
NCBI-GeneID: 100127355
NCBI-ProteinID: NP_001106524
Ensembl: ENSSSCG00000012825
Vega: OTTSUSG00000004965
UniProt: A9QT41
LinkDB
Position
X
AA seq 419 aa
MSRTPWKSQPCEMVQPSGGPAGDQDVLGEESSLGKPTMLHLPSEQGAPETFQRCLEENQE
LRDAIRQSNQMLRERCEELQRFQGSQREEKEFLMQKFCEARRLVERLSLEKLELRRQREQ
ALQEVELLKTCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKERQALESRVRATSEQ
VRQLENEREALQQQHSVQVDQLRLQSQSMEAALRMERQAASEEKRKLAQLQVAYHQLFQE
YDNHIKSSVVSSERNRGLQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPV
LKAQADIYKADFQAERQAREQLAERKELLQEQLEQLQREYSRLKTSCQESARIEDMRKRH
VEVSQPTLPPAPAHHSFHPALPSQRRSPPEEPPNFCCPKCQYQAPDMDTLQIHVMECIE
NT seq 1260 nt   +upstreamnt  +downstreamnt
atgagcaggaccccctggaagagtcagccgtgtgagatggtgcagcctagcggcggcccg
gcaggggaccaggacgtgctgggtgaagagtcctctctggggaagccaaccatgctccac
ctgccttcggagcagggtgctcctgagaccttccagcgctgcctggaggagaatcaagag
ctccgagatgccatccggcagagcaaccagatgctgcgggagcgctgtgaggagctgcag
cgtttccagggcagccagcgggaggagaaggagtttctcatgcagaagttctgcgaggcc
aggcgcctggtcgagaggctgagcctcgagaagctggagctgcgcaggcagagggagcag
gccctgcaggaggtggagctcctgaagacctgccagcagcagatggcagaggacaaggcc
tcagtgaaagcccaggtgacgtccttgctgggggagctgcaggagagccagagtcgcttg
gaggccgccaccaaggagcggcaggctctggagagcagggttcgcgccactagcgagcag
gtccggcagctggagaacgagcgggaggccctgcagcagcagcacagcgtgcaggtggac
cagctgcgcctgcagagccagagcatggaggccgccctgcgcatggagcgccaggccgcc
tcggaggagaagcggaagctggcccagctgcaggtggcctaccaccagcttttccaggag
tatgacaaccacatcaagagcagcgtggtgagcagcgagcgcaaccgaggattgcagctg
gaagacctcaagcagcagctgcagcaggccgaggaggccctggtggccaaacaggaagtg
atcgacaagctgaaggaggaggccgagcagcacaagattgtgatggagacggttccggtg
ctcaaagcccaggccgacatctacaaggcggacttccaggccgagcggcaggcccgggag
cagctggctgagaggaaggagctcctgcaggagcagctggagcagctgcagagggagtac
agccggctgaagaccagctgccaggaatcggccaggatcgaagacatgaggaagcggcac
gtcgaggtctcccagcccaccttgccccccgccccagctcatcactcctttcacccggcc
ctgcccagccagaggagaagcccccccgaggagccccccaacttctgttgccccaagtgc
cagtaccaggctcccgacatggacaccctgcagatccatgtcatggagtgtatcgagtag

KEGG   Sus scrofa (pig): 100135662
Entry
100135662         CDS       T01009                                 

Gene name
CHUK
Definition
(RefSeq) inhibitor of nuclear factor kappa-B kinase subunit alpha
  KO
K04467  inhibitor of nuclear factor kappa-B kinase subunit alpha [EC:2.7.11.10]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc01523  Antifolate resistance
ssc04010  MAPK signaling pathway
ssc04014  Ras signaling pathway
ssc04062  Chemokine signaling pathway
ssc04064  NF-kappa B signaling pathway
ssc04068  FoxO signaling pathway
ssc04150  mTOR signaling pathway
ssc04151  PI3K-Akt signaling pathway
ssc04210  Apoptosis
ssc04380  Osteoclast differentiation
ssc04620  Toll-like receptor signaling pathway
ssc04621  NOD-like receptor signaling pathway
ssc04622  RIG-I-like receptor signaling pathway
ssc04623  Cytosolic DNA-sensing pathway
ssc04625  C-type lectin receptor signaling pathway
ssc04657  IL-17 signaling pathway
ssc04658  Th1 and Th2 cell differentiation
ssc04659  Th17 cell differentiation
ssc04660  T cell receptor signaling pathway
ssc04662  B cell receptor signaling pathway
ssc04668  TNF signaling pathway
ssc04920  Adipocytokine signaling pathway
ssc05010  Alzheimer disease
ssc05132  Salmonella infection
ssc05135  Yersinia infection
ssc05142  Chagas disease
ssc05145  Toxoplasmosis
ssc05160  Hepatitis C
ssc05161  Hepatitis B
ssc05162  Measles
ssc05163  Human cytomegalovirus infection
ssc05164  Influenza A
ssc05165  Human papillomavirus infection
ssc05166  Human T-cell leukemia virus 1 infection
ssc05167  Kaposi sarcoma-associated herpesvirus infection
ssc05168  Herpes simplex virus 1 infection
ssc05169  Epstein-Barr virus infection
ssc05170  Human immunodeficiency virus 1 infection
ssc05171  Coronavirus disease - COVID-19
ssc05200  Pathways in cancer
ssc05212  Pancreatic cancer
ssc05215  Prostate cancer
ssc05220  Chronic myeloid leukemia
ssc05221  Acute myeloid leukemia
ssc05222  Small cell lung cancer
ssc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ssc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100135662 (CHUK)
   04014 Ras signaling pathway
    100135662 (CHUK)
   04064 NF-kappa B signaling pathway
    100135662 (CHUK)
   04668 TNF signaling pathway
    100135662 (CHUK)
   04068 FoxO signaling pathway
    100135662 (CHUK)
   04151 PI3K-Akt signaling pathway
    100135662 (CHUK)
   04150 mTOR signaling pathway
    100135662 (CHUK)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100135662 (CHUK)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100135662 (CHUK)
   04621 NOD-like receptor signaling pathway
    100135662 (CHUK)
   04622 RIG-I-like receptor signaling pathway
    100135662 (CHUK)
   04623 Cytosolic DNA-sensing pathway
    100135662 (CHUK)
   04625 C-type lectin receptor signaling pathway
    100135662 (CHUK)
   04660 T cell receptor signaling pathway
    100135662 (CHUK)
   04658 Th1 and Th2 cell differentiation
    100135662 (CHUK)
   04659 Th17 cell differentiation
    100135662 (CHUK)
   04657 IL-17 signaling pathway
    100135662 (CHUK)
   04662 B cell receptor signaling pathway
    100135662 (CHUK)
   04062 Chemokine signaling pathway
    100135662 (CHUK)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100135662 (CHUK)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100135662 (CHUK)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100135662 (CHUK)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100135662 (CHUK)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100135662 (CHUK)
   05221 Acute myeloid leukemia
    100135662 (CHUK)
   05220 Chronic myeloid leukemia
    100135662 (CHUK)
   05215 Prostate cancer
    100135662 (CHUK)
   05222 Small cell lung cancer
    100135662 (CHUK)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100135662 (CHUK)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100135662 (CHUK)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100135662 (CHUK)
   05135 Yersinia infection
    100135662 (CHUK)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100135662 (CHUK)
   05170 Human immunodeficiency virus 1 infection
    100135662 (CHUK)
   05161 Hepatitis B
    100135662 (CHUK)
   05160 Hepatitis C
    100135662 (CHUK)
   05171 Coronavirus disease - COVID-19
    100135662 (CHUK)
   05164 Influenza A
    100135662 (CHUK)
   05162 Measles
    100135662 (CHUK)
   05168 Herpes simplex virus 1 infection
    100135662 (CHUK)
   05163 Human cytomegalovirus infection
    100135662 (CHUK)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100135662 (CHUK)
   05169 Epstein-Barr virus infection
    100135662 (CHUK)
   05165 Human papillomavirus infection
    100135662 (CHUK)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100135662 (CHUK)
   05142 Chagas disease
    100135662 (CHUK)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    100135662 (CHUK)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ssc01001]
    100135662 (CHUK)
Enzymes [BR:ssc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.10  IkappaB kinase
     100135662 (CHUK)
Protein kinases [BR:ssc01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   100135662 (CHUK)
SSDB
Motif
Pfam: IKBKB_SDD Pkinase PK_Tyr_Ser-Thr IKKbetaNEMObind Pkinase_fungal Kdo TBK1_ULD
Other DBs
NCBI-GeneID: 100135662
NCBI-ProteinID: NP_001107751
Ensembl: ENSSSCG00000010548
Vega: OTTSUSG00000001827
UniProt: B0LXP6 A0A4X1U511
LinkDB
Position
14
AA seq 744 aa
MERPPGLRPGAGGPWEMRERLGTGGFGNVCLYQHRELDLKIAIKSCRLELSTKNRERWCH
EIQIMKKLNHDNVVKACDVPEELNFLINDVPLLAMEYCSGGDLRKLLNKPENCCGLKESQ
ILSLLSDIGSGIRYLHENKIIHRDLKPENIVLQDVGGKILHKIIDLGYAKDVDQGSLCTS
FVGTLQYLAPELFENKPYTATVDYWSFGTMVFECIAGYRPFLHHLQPFTWHEKIKKKDPK
CIFACEEMTGEVRFSSHLPQPNSLCSLIVEPMENWLQLMLNWDPQQRGGPIDLTLKQPKC
FILMDHILNLKIVHILNMTSAKIISFLLPPDESLHSLQSRIERETGINTGSQELLSEMGI
SLDPRKPASQCVLDGVRGCDSYMVYLFDKSKTVYEGPFASRSLSDCVNYIVQDSKIQLPI
IQLRKVWAEAVHYVSGLKEDYSRLFQGQRAAMLSLLRYNANLTKMKNTLISASQQLKAKL
EFFHKSIQLDLERYSEQMTYGISSEKMLKAWKEMEEKAIHYAEVGVIGYLEDQIMSLHTE
IMELQKSPYGRRQGDLMESLEQRAIDLYKQLKHRPADHSYSDSTEMVKIIVHTVQSQDRV
LKELFGHLSKLLGCKQKIIDLLPKVEMALSNIKEADNTVMFMQGKRQKEIWHLLKIACTQ
SSARSLVGSSLEGVTPQASAWVPPTSAERERPLSCVVTPQDGETLAQMIEENLNCLGHLS
SIIHEANEKQGTNMMNLDWSWLTG
NT seq 2235 nt   +upstreamnt  +downstreamnt
atggagcggcccccggggctgcggccgggcgcgggcgggccctgggagatgcgggagcgg
ctgggcactggcggcttcgggaacgtctgcttgtatcaacatcgggaacttgatctcaaa
atagcaattaagtcctgtcgcctagagctaagtaccaaaaacagagaacggtggtgccat
gaaatccagatcatgaagaagttgaaccacgacaatgtcgtaaaggcctgtgatgttcct
gaggaactgaattttttgattaatgatgtgcctcttctagcaatggaatattgttctgga
ggagatctgcgtaagctactcaacaaaccagaaaattgctgtggacttaaagaaagccag
atactttctttactgagcgatataggatctgggattcgatatttgcatgaaaataaaatt
atacatcgtgatctaaaacctgaaaacatagttcttcaggatgttggtggaaagattttg
cataaaataattgatttgggatatgccaaagatgttgatcaaggaagtctgtgtacgtct
tttgtaggaacattgcagtatctggcccctgagctctttgagaataagccttacacagcc
actgttgattattggagctttgggactatggtgtttgaatgtatagctgggtataggcct
tttttgcatcatctgcagccatttacctggcatgagaaaattaagaagaaggatccaaag
tgtatatttgcatgtgaagagatgacgggagaagttcgatttagtagccatttacctcaa
ccaaatagcctttgtagtttaatagtagaacccatggaaaactggctacagttgatgctg
aactgggatcctcagcagagaggaggacctattgatctcactttgaagcagccaaaatgt
tttatattaatggatcacattctgaatttgaagatagtacacatcctaaatatgacttct
gcaaagataatttcttttctgttaccacctgatgaaagtcttcattcactgcagtctcgt
attgagcgtgaaactggaataaatactggttctcaagagcttctttcagagatgggaatt
tctcttgatcctcggaaaccagcctctcaatgtgttttggatggagtcaggggctgtgat
agctatatggtttatttgtttgataagagtaagactgtatatgaaggaccatttgcttcc
agaagcttatctgactgcgtaaattatattgtacaggacagcaaaatacagcttccaatt
atacagctgcgtaaagtatgggccgaagcagtacactatgtgtctgggctaaaagaagac
tatagcaggctctttcagggacagagagcagcaatgttaagtcttcttagatataatgcg
aacttgacaaaaatgaagaacaccttgatctcagcatctcagcaattgaaagcgaaattg
gagttttttcacaaaagcattcaacttgacttggaaagatatagtgagcagatgacttat
gggatatcctcagaaaaaatgttgaaagcatggaaagaaatggaagaaaaggctatccac
tatgctgaggtgggtgtcattggatatctggaggatcaaatcatgtccctgcacaccgaa
atcatggagctacagaagagcccctatggacggcgtcagggagacttgatggaatctctg
gaacagcgcgccattgatctctataagcagttaaagcacagacctgcagatcactcttac
agcgacagcacggagatggtgaaaatcattgtgcatactgtgcagagtcaggaccgggtt
ctcaaggagctgtttggtcatttgagcaagttgttgggctgtaagcagaagattattgat
ctactgcccaaggtggagatggctctcagtaacatcaaagaagctgacaatactgtcatg
tttatgcagggaaagaggcagaaagaaatatggcatctccttaaaattgcctgtacacag
agttctgctcggtcccttgtaggatccagtctagaaggtgtaacccctcaggcctcagca
tgggtgcccccaacttcagcagaacgtgaacgtcctctgtcatgcgtggtaactcctcaa
gatggggagactttagcacaaatgatagaagaaaatttgaactgtcttggccatttaagc
tctattattcatgaagcaaatgagaaacagggcactaatatgatgaatcttgattggagt
tggttaacaggatga

DBGET integrated database retrieval system