KEGG   Sus scrofa (pig): 100113425
Entry
100113425         CDS       T01009                                 

Gene name
BMP4
Definition
(RefSeq) bone morphogenetic protein 4 precursor
  KO
K04662  bone morphogenetic protein 4
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04060  Cytokine-cytokine receptor interaction
ssc04350  TGF-beta signaling pathway
ssc04390  Hippo signaling pathway
ssc04550  Signaling pathways regulating pluripotency of stem cells
ssc04919  Thyroid hormone signaling pathway
ssc05200  Pathways in cancer
ssc05217  Basal cell carcinoma
ssc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    100113425 (BMP4)
   04390 Hippo signaling pathway
    100113425 (BMP4)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100113425 (BMP4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100113425 (BMP4)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    100113425 (BMP4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100113425 (BMP4)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    100113425 (BMP4)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100113425 (BMP4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ssc04052]
    100113425 (BMP4)
   00536 Glycosaminoglycan binding proteins [BR:ssc00536]
    100113425 (BMP4)
Cytokines and growth factors [BR:ssc04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   100113425 (BMP4)
Glycosaminoglycan binding proteins [BR:ssc00536]
 Heparan sulfate / Heparin
  Morphogens
   100113425 (BMP4)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta
Other DBs
NCBI-GeneID: 100113425
NCBI-ProteinID: NP_001094501
Ensembl: ENSSSCG00000005045
UniProt: A0A4X1WD52 A7LJT9
LinkDB
Position
1
AA seq 409 aa
MIPGNRMLMVVLLCQVLLGGASHASLIPETGKKKVAEIQGHAGGRRSGQSHELLRDFEAT
LLQMFGLRRRPQPSKSAVIPDYMRDLYRLQSGEEEEEEQTHSVGLEYPERPASRANTVRS
FHHEEHLENIPGTSENSAFRFLFNLSSIPENEVISSAELRLFREQVDQGPDWEQGFHRIN
IYEVMKPPPEVVPGHLITRLLDTRLVHHNVTRWETFDVSPAVLRWTREKQPNYGLAIEVT
HLHQTRTHQGQHVRISRSLPQGSGDWAQLRPLLVTFGHDGRGHALTRRRRAKRSPKHHPQ
RARKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQT
LVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR
NT seq 1230 nt   +upstreamnt  +downstreamnt
atgattcctggtaaccgaatgctgatggtcgttttattatgccaagtcctgctaggaggc
gcgagccatgctagtttgatacctgagacggggaagaaaaaagtcgccgagattcagggc
cacgcgggaggacgccgctcagggcagagccatgagctccttcgggacttcgaggctaca
cttctgcagatgttcgggctgcgtcgccgcccgcagcctagcaagagcgccgtcatccca
gattacatgcgggatctttaccggcttcagtctggagaggaggaggaggaagagcagacc
cacagcgttggtctcgagtatcccgagcgccctgccagtcgggccaacaccgtgagaagc
tttcaccacgaagaacatctggagaacatcccagggaccagcgaaaactctgcttttcgt
ttcctctttaacctcagcagcatcccagagaacgaggtgatctcatccgcagagcttcga
ctcttccgggagcaggtggaccagggccctgactgggagcagggcttccatcgtataaac
atttatgaggttatgaagcccccaccagaagtggtgcctggacacctcatcacacgacta
ctggacacgagactggtccaccacaatgtgacacggtgggaaacttttgatgtgagccct
gcggtccttcgctggacccgggagaagcagccaaactatgggctggccattgaggtgacc
cacctccatcagacacggacccaccagggccagcatgtcaggattagccgatcgttacct
caagggagtggggactgggcccagctccggcccctcctggtcacatttggccatgatggc
cggggacatgccttgacccgacgccggagggccaagcgtagccccaagcatcacccacag
agggctcggaagaagaataagaactgccggcgccactcgctctatgtggacttcagtgac
gtgggctggaatgactggattgtggctccaccaggctaccaggccttctactgccatggg
gactgcccctttccactggctgaccacctcaactcaaccaatcatgccatcgttcagacc
ctggtcaactctgttaattccagtatccccaaagcctgttgtgttcccaccgaactgagt
gccatctccatgctatacctggatgagtatgacaaggtggtactgaaaaattatcaggag
atggtagtagagggatgtggttgccgctga

KEGG   Sus scrofa (pig): 100157103
Entry
100157103         CDS       T01009                                 

Gene name
BMP2
Definition
(RefSeq) bone morphogenetic protein 2 precursor
  KO
K21283  bone morphogenetic protein 2
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04060  Cytokine-cytokine receptor interaction
ssc04350  TGF-beta signaling pathway
ssc04390  Hippo signaling pathway
ssc05200  Pathways in cancer
ssc05217  Basal cell carcinoma
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    100157103 (BMP2)
   04390 Hippo signaling pathway
    100157103 (BMP2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100157103 (BMP2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100157103 (BMP2)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    100157103 (BMP2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ssc04052]
    100157103 (BMP2)
   00536 Glycosaminoglycan binding proteins [BR:ssc00536]
    100157103 (BMP2)
Cytokines and growth factors [BR:ssc04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   100157103 (BMP2)
Glycosaminoglycan binding proteins [BR:ssc00536]
 Heparan sulfate / Heparin
  Morphogens
   100157103 (BMP2)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta
Other DBs
NCBI-GeneID: 100157103
NCBI-ProteinID: NP_001182328
Ensembl: ENSSSCG00000022670
UniProt: E1AXT2 A0A4X1UEL6
LinkDB
Position
17
AA seq 395 aa
MVAGTRCLLALLLPQVLLGGAADLIPELGRRKFAASTGLSSSQPSDDVLSEFELRLLSMF
GLKQRPTPSRDAVVPPYMLDLYRRHSGQPGAPAPDHRLERAASLANTVRSFHHEESLEEL
PEMSGKTTRRFFFNLTSVPTEEFITSAELQVFREQTQETLDNSSSFHHRINIYEIIKPAT
ANSKFPVTRLLDTRLVTPNASRWESFDVTPAVMRWTAQGVANHGFVVEVAHPEDSPEVSK
RHVRISRSLHQDEHSWSQIRPLLVTFGHDGKGHPLHKREKRQAKHKQRKRLKSSCKRHPL
YVDFSDVGWNDWIVAPPGYHAFYCHGECPFPLADHLNSTNHAIVQTLVNSVNSKIPKACC
VPTELSAISMLYLDENEKVVLKNYQDMVVEGCGCR
NT seq 1188 nt   +upstreamnt  +downstreamnt
atggtggccgggacccgctgtcttctagcgttgctgcttccccaggtcctcctgggcggc
gcggccgacctcattcccgagctgggccggaggaagttcgcggcgtctactggcctctcc
tcttcccagccctcggacgacgtcctcagcgagtttgagttgcggctgctcagcatgttc
ggcctgaagcagagacccaccccgagcagggacgccgtggtgcccccctacatgctggac
ctgtaccgccgacattcgggtcagccaggcgcgcctgccccggaccaccggctggagagg
gcagccagcttggccaacaccgtgcgcagcttccaccacgaagaatctttggaagaactg
ccagaaatgagtggaaaaacaacccggcgcttcttctttaatttaacttctgtccccacc
gaggagtttatcacctcagcagaacttcaggtctttcgggagcagacacaggagactttg
gataacagtagcagtttccatcaccgaattaatatttatgaaatcatcaaacctgcaaca
gccaactccaagttccccgtgaccagacttttggacaccaggttggtgactccgaatgcc
agcaggtgggagagcttcgacgtcacccccgctgtgatgcggtggactgcacagggggtc
gccaaccacgggttcgtggtggaagtggcccacccggaggacagcccggaggtctccaag
aggcatgtgcggattagcaggtctttgcaccaagatgagcacagctggtcacaaataaga
cccttgctagtcactttcggccacgatgggaaaggacaccctctgcacaaaagggaaaag
cgtcaagcaaaacacaaacagcgcaagcgcctgaaatccagctgcaagagacaccctttg
tacgtggacttcagtgatgtgggctggaatgactggatcgtagcccccccggggtatcat
gccttttactgccacggggagtgccctttccccctggctgatcacctgaactccacgaat
cacgccatcgtccagacgttggtcaactccgttaactctaagatcccaaaggcgtgctgt
gtcccaacagaactcagtgccatctccatgctgtaccttgacgagaacgaaaaggtggta
ttaaagaactaccaggacatggttgtggagggttgtgggtgtcgttag

DBGET integrated database retrieval system