KEGG   Sus scrofa (pig): 100125959
Entry
100125959         CDS       T01009                                 

Gene name
MDM2
Definition
(RefSeq) E3 ubiquitin-protein ligase Mdm2
  KO
K06643  E3 ubiquitin-protein ligase Mdm2 [EC:2.3.2.27]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc01522  Endocrine resistance
ssc01524  Platinum drug resistance
ssc04068  FoxO signaling pathway
ssc04110  Cell cycle
ssc04115  p53 signaling pathway
ssc04120  Ubiquitin mediated proteolysis
ssc04144  Endocytosis
ssc04151  PI3K-Akt signaling pathway
ssc04218  Cellular senescence
ssc04625  C-type lectin receptor signaling pathway
ssc04919  Thyroid hormone signaling pathway
ssc05163  Human cytomegalovirus infection
ssc05165  Human papillomavirus infection
ssc05169  Epstein-Barr virus infection
ssc05200  Pathways in cancer
ssc05202  Transcriptional misregulation in cancer
ssc05203  Viral carcinogenesis
ssc05205  Proteoglycans in cancer
ssc05206  MicroRNAs in cancer
ssc05214  Glioma
ssc05215  Prostate cancer
ssc05218  Melanoma
ssc05219  Bladder cancer
ssc05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100125959 (MDM2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100125959 (MDM2)
   04151 PI3K-Akt signaling pathway
    100125959 (MDM2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100125959 (MDM2)
  09143 Cell growth and death
   04110 Cell cycle
    100125959 (MDM2)
   04115 p53 signaling pathway
    100125959 (MDM2)
   04218 Cellular senescence
    100125959 (MDM2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100125959 (MDM2)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    100125959 (MDM2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100125959 (MDM2)
   05202 Transcriptional misregulation in cancer
    100125959 (MDM2)
   05206 MicroRNAs in cancer
    100125959 (MDM2)
   05205 Proteoglycans in cancer
    100125959 (MDM2)
   05203 Viral carcinogenesis
    100125959 (MDM2)
  09162 Cancer: specific types
   05214 Glioma
    100125959 (MDM2)
   05220 Chronic myeloid leukemia
    100125959 (MDM2)
   05218 Melanoma
    100125959 (MDM2)
   05219 Bladder cancer
    100125959 (MDM2)
   05215 Prostate cancer
    100125959 (MDM2)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    100125959 (MDM2)
   05169 Epstein-Barr virus infection
    100125959 (MDM2)
   05165 Human papillomavirus infection
    100125959 (MDM2)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100125959 (MDM2)
   01522 Endocrine resistance
    100125959 (MDM2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ssc04131]
    100125959 (MDM2)
   04121 Ubiquitin system [BR:ssc04121]
    100125959 (MDM2)
Enzymes [BR:ssc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     100125959 (MDM2)
Membrane trafficking [BR:ssc04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    100125959 (MDM2)
Ubiquitin system [BR:ssc04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   MDM2/MDM4 proteins
    100125959 (MDM2)
SSDB
Motif
Pfam: zf-C3HC4_3 SWIB zf-RanBP zf-RING_2 zf-FPG_IleRS
Other DBs
NCBI-GeneID: 100125959
NCBI-ProteinID: NP_001098773
Ensembl: ENSSSCG00000000488
UniProt: A7Y496
LinkDB
Position
5
AA seq 491 aa
MCNTNMSVSTDGAVSTSQIPASEQETLVRPKPLLLKLLKSVGAQKDTYTMKEVTFYLGQY
IMTKRLYDEKQQHIVYCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLIVVNQQEPSDSST
SVSENRCHLEGGSDQKDLVQELQEEKPSSSDLISRPSTSSRRRAVSETEENSDELPGERQ
RKRHKSDNISLSFDESLALCVIREICCERSSSSDSTGTPSNPDLDAGVSEHSGDWLDQDS
VSDQFSVEFEVESLDSEDYSLSEEGQELSDEDDEVYRATVYQAGQSDTDSFEEDPEISLA
DYWKCTSCNEMNPPLPPHCNRCWALRENWLPEDKGKDKGKMPEEARLENSTQVEEGFDVP
DCKKPTVNDSRESCAEENDDKIPQAFLSQESEDYSQPSTSNSIIYSSQEDVKEIEREEIQ
DKEESAESSFPLNAIEPCVICQGRPKNGCIVHGKTGHLMACFTCAKKLKKRNKPCPVCRQ
PIQMIVLTYFP
NT seq 1476 nt   +upstreamnt  +downstreamnt
atgtgcaataccaacatgtctgtgtccactgatggtgctgtaagcacctcacagattcca
gcttcggaacaggagaccctggtcagaccaaagccattgcttttgaagttgttaaagtct
gttggagcacagaaagacacttatactatgaaagaggttacattttatcttggccagtat
attatgactaaacgattatatgatgagaaacaacagcatattgtatattgttcaaatgat
cttctaggggatttatttggagtgccaagcttctctgtgaaagaacacaggaaaatatat
acaatgatctacagaaacttgattgtagtcaatcagcaggaaccgtcagattccagcaca
tctgtgagtgaaaacaggtgtcaccttgaaggtggaagtgatcaaaaggaccttgtgcag
gagctacaggaagagaaaccttcatcttcagacttgatttctagaccatctacctcatct
agaaggagagcagttagtgaaacagaagaaaattcagatgaattacctggtgaacgacaa
agaaagcgccacaaatctgataatatttccctttcctttgatgaaagtcttgctctatgt
gtaataagggagatatgttgtgaaagaagcagtagcagtgattcaacagggactccatca
aatccggatctcgacgctggtgtgagtgaacattctggtgattggttggatcaggattca
gtttcagatcaattcagtgtggaatttgaagttgagtctcttgattcagaagattatagc
cttagtgaagaaggacaagaactctcagatgaagatgatgaggtatatcgagctactgtg
tatcaggctgggcagagtgatacagattccttcgaagaagatcctgaaatttccttagcg
gactattggaagtgtacttcatgcaatgaaatgaatcctccccttccacctcattgtaac
agatgttgggcccttcgtgaaaattggcttcctgaagataaagggaaagataaagggaag
atgcctgaggaagccagactagaaaactcaacacaagtagaagagggctttgatgtccct
gactgtaagaaacctacagtgaatgattccagagaatcatgtgctgaggaaaatgatgat
aagatcccacaagccttcctatcccaagaaagcgaggactattctcagccatcaacctct
aatagcatcatttatagtagccaagaagatgtcaaagagattgagagggaagaaatacaa
gacaaagaagaaagtgcggaatctagttttcctcttaatgccattgaaccttgtgtgatt
tgccaaggtcgacctaaaaatggttgcatcgtccatggcaaaacaggacatcttatggca
tgctttacgtgtgcaaagaagctaaagaaaaggaataagccttgcccagtatgtagacaa
ccaattcaaatgattgtgctaacttatttcccctag

DBGET integrated database retrieval system