KEGG   Sus scrofa (pig): 100126276
Entry
100126276         CDS       T01009                                 

Gene name
WNT10B
Definition
(RefSeq) protein Wnt-10b precursor
  KO
K01357  wingless-type MMTV integration site family, member 10
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04150  mTOR signaling pathway
ssc04310  Wnt signaling pathway
ssc04390  Hippo signaling pathway
ssc04550  Signaling pathways regulating pluripotency of stem cells
ssc04916  Melanogenesis
ssc04934  Cushing syndrome
ssc05010  Alzheimer disease
ssc05022  Pathways of neurodegeneration - multiple diseases
ssc05165  Human papillomavirus infection
ssc05200  Pathways in cancer
ssc05205  Proteoglycans in cancer
ssc05217  Basal cell carcinoma
ssc05224  Breast cancer
ssc05225  Hepatocellular carcinoma
ssc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100126276 (WNT10B)
   04390 Hippo signaling pathway
    100126276 (WNT10B)
   04150 mTOR signaling pathway
    100126276 (WNT10B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100126276 (WNT10B)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100126276 (WNT10B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100126276 (WNT10B)
   05205 Proteoglycans in cancer
    100126276 (WNT10B)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100126276 (WNT10B)
   05226 Gastric cancer
    100126276 (WNT10B)
   05217 Basal cell carcinoma
    100126276 (WNT10B)
   05224 Breast cancer
    100126276 (WNT10B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100126276 (WNT10B)
   05022 Pathways of neurodegeneration - multiple diseases
    100126276 (WNT10B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100126276 (WNT10B)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100126276 (WNT10B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:ssc00536]
    100126276 (WNT10B)
Glycosaminoglycan binding proteins [BR:ssc00536]
 Heparan sulfate / Heparin
  Morphogens
   100126276 (WNT10B)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 100126276
NCBI-ProteinID: NP_001273945
Ensembl: ENSSSCG00000000182
UniProt: U5XKA6
LinkDB
Position
5
AA seq 389 aa
MRKEPGPRPPPSGLAGLLFLALCSRALSNEILGLKLPGEPPLTANTVCLTLSGLSKRQLG
LCLRSPDVTASALQGLHIAVHECQHQLRDQRWNCSALEGGGRLPHHSAILKRGFRESAFS
FSMLAAGVMHAVATACSLGKLVSCGCGWKGSGEQDRLRAKLLQLQALSRGKSFPHSLPSP
GPGSSPSPGPQDTWEWGGCNHDMDFGEKFSRDFLDSREAPRDIQARMRIHNNRVGRQVVT
ESLKRKCKCHGTSGSCQFKTCWRAAPEFRAVGTALRERLGRAIFIDTHNRNSGAFQPRLR
PRRLSGELVYFEKSPDFCERDPSVGSPGTRGRACNKTSRLLDGCGSLCCGRGHNVLRQTR
VERCHCRFHWCCYVLCDECKVTEWVNVCK
NT seq 1170 nt   +upstreamnt  +downstreamnt
atgcggaaggagcccgggccgcggcctccgccctcgggcctcgcgggtctcctgttcctg
gcgttgtgcagtcgggccctaagcaatgagattctgggcctgaagctgcccggcgagccg
ccgctgaccgccaacaccgtctgcttgacgctgtcgggcctgagcaagcggcagttaggc
ctgtgcctgcgcagccccgacgtgacggcgtctgcgcttcagggcctgcacatcgccgtc
cacgagtgtcagcaccagctgcgcgaccagcgctggaactgctccgcgctcgagggcggc
ggccgcctgccgcaccacagcgccatcctcaagcgcggtttccgagagagcgctttttcc
ttctccatgctggctgctggggtcatgcacgcggtagccaccgcctgcagcctgggcaag
ctggtgagctgcggctgcggctggaagggcagtggtgagcaggatcggctgagggccaaa
ctgctacagctgcaggcactgtcccgaggcaagagttttccccactccctgcccagccca
ggccctggctcaagccccagccccggcccccaggacacgtgggaatggggtggctgtaac
catgacatggactttggagagaagttctctcgggatttcttggattccagggaagctccc
cgggacatccaggcacgaatgcgaatccacaacaacagggtggggcgtcaggtggtaact
gaaagtctgaagcggaaatgcaagtgccatggcacgtcaggcagctgccagttcaagacg
tgctggagggcagccccggagttccgggccgtggggacagccttgagggagcggctgggc
cgggccatcttcattgatacccacaaccgtaactccggagccttccaaccccgccttcgt
ccccggcgcctttcaggagagctggtctactttgagaagtctcccgacttctgtgagcga
gaccccagcgtgggctccccgggcacgcggggccgggcctgcaacaagaccagccgcctg
ctggatggttgtggcagcctgtgctgtggccgtgggcacaacgtgctgcggcagacacga
gttgagcgctgtcattgccgcttccactggtgctgctacgtgctgtgtgatgagtgcaag
gtcacagagtgggtcaatgtgtgtaagtga

KEGG   Sus scrofa (pig): 100153445
Entry
100153445         CDS       T01009                                 

Gene name
WNT7A
Definition
(RefSeq) protein Wnt-7a
  KO
K00572  wingless-type MMTV integration site family, member 7
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04150  mTOR signaling pathway
ssc04310  Wnt signaling pathway
ssc04390  Hippo signaling pathway
ssc04550  Signaling pathways regulating pluripotency of stem cells
ssc04916  Melanogenesis
ssc04934  Cushing syndrome
ssc05010  Alzheimer disease
ssc05022  Pathways of neurodegeneration - multiple diseases
ssc05165  Human papillomavirus infection
ssc05200  Pathways in cancer
ssc05205  Proteoglycans in cancer
ssc05217  Basal cell carcinoma
ssc05224  Breast cancer
ssc05225  Hepatocellular carcinoma
ssc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100153445 (WNT7A)
   04390 Hippo signaling pathway
    100153445 (WNT7A)
   04150 mTOR signaling pathway
    100153445 (WNT7A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100153445 (WNT7A)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100153445 (WNT7A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100153445 (WNT7A)
   05205 Proteoglycans in cancer
    100153445 (WNT7A)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100153445 (WNT7A)
   05226 Gastric cancer
    100153445 (WNT7A)
   05217 Basal cell carcinoma
    100153445 (WNT7A)
   05224 Breast cancer
    100153445 (WNT7A)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100153445 (WNT7A)
   05022 Pathways of neurodegeneration - multiple diseases
    100153445 (WNT7A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100153445 (WNT7A)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100153445 (WNT7A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:ssc00536]
    100153445 (WNT7A)
Glycosaminoglycan binding proteins [BR:ssc00536]
 Heparan sulfate / Heparin
  Morphogens
   100153445 (WNT7A)
SSDB
Motif
Pfam: wnt COG6
Other DBs
NCBI-GeneID: 100153445
NCBI-ProteinID: XP_003132444
UniProt: A0A287AGQ6
LinkDB
Position
13
AA seq 349 aa
MNRKARRCLGHLFLSLGLVYLRIGGFSSVVALGASIICNKIPGLAPRQRAICQSRPDAII
VIGEGSQMGLDECQFQFRNGRWNCSALGERTVFGKELKVGSREAAFTYAIIAAGVAHAIT
AACTQGNLSDCGCDKEKQGQYHRDEGWKWGGCSADIRYGIGFAKVFVDAREIKQNARTLM
NLHNNEAGRKILEENMKLECKCHGVSGSCTTKTCWTTLPQFRELGYVLKDKYNEAVHVEP
VRASRNKRPTFLKIKKPLSYRKPMDTDLVYIEKSPNYCEEDPVTGSVGTQGRACNKTAPQ
ASGCDLMCCGRGYNTHQYARVWQCNCKFHWCCYVKCNTCSERTEVYTCK
NT seq 1050 nt   +upstreamnt  +downstreamnt
atgaaccggaaagcgcggcgctgcctgggccacctctttctcagcttgggcttggtctac
ctccggatcggtggcttctcctcggtggtagctctgggcgcgagcatcatctgtaacaag
atcccaggcctggctcccagacagcgggcgatctgccagagccggcccgacgccatcatc
gtcataggagaaggctcgcaaatgggcctggacgagtgtcagtttcagttccgcaatggc
cgctggaactgctcggcactgggggagcgcaccgtcttcggaaaagagctcaaagtgggg
agccgcgaggctgccttcacatacgccatcatcgctgccggcgtggcccacgccatcact
gctgcctgcacccagggcaacctgagcgactgtggctgcgacaaggagaagcaaggccag
taccaccgggacgagggctggaagtggggtggctgctctgccgacatccgctacggcatc
ggcttcgccaaggtctttgtggatgcccgggagatcaagcagaatgcccggactctcatg
aacttacacaataacgaggcaggccgaaagatcctggaggagaacatgaagctggagtgt
aaatgccatggcgtgtcaggctcctgcaccaccaagacctgctggaccacactgccgcag
ttccgagagctgggctacgtgctcaaggacaagtacaacgaggctgtccacgtggagccc
gtgcgcgccagccgcaacaagcggcccaccttcctgaagatcaagaagccgctgtcctac
cgcaagcccatggacaccgacctggtgtacatcgagaagtcgcccaactactgcgaggag
gacccggtgacaggcagtgtgggcacacagggccgcgcctgcaacaagacggccccccag
gccagtggctgtgacctcatgtgctgcggccgcggctacaacacccaccagtatgcccgc
gtgtggcagtgcaactgcaagttccactggtgctgctacgtcaaatgcaacacgtgcagc
gagcgcacggaggtctatacgtgcaagtga

KEGG   Sus scrofa (pig): 100327037
Entry
100327037         CDS       T01009                                 

Gene name
WNT4
Definition
(RefSeq) protein Wnt-4
  KO
K00408  wingless-type MMTV integration site family, member 4
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04150  mTOR signaling pathway
ssc04310  Wnt signaling pathway
ssc04360  Axon guidance
ssc04390  Hippo signaling pathway
ssc04550  Signaling pathways regulating pluripotency of stem cells
ssc04916  Melanogenesis
ssc04919  Thyroid hormone signaling pathway
ssc04934  Cushing syndrome
ssc05010  Alzheimer disease
ssc05022  Pathways of neurodegeneration - multiple diseases
ssc05165  Human papillomavirus infection
ssc05200  Pathways in cancer
ssc05205  Proteoglycans in cancer
ssc05217  Basal cell carcinoma
ssc05224  Breast cancer
ssc05225  Hepatocellular carcinoma
ssc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100327037 (WNT4)
   04390 Hippo signaling pathway
    100327037 (WNT4)
   04150 mTOR signaling pathway
    100327037 (WNT4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100327037 (WNT4)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    100327037 (WNT4)
   04916 Melanogenesis
    100327037 (WNT4)
  09158 Development and regeneration
   04360 Axon guidance
    100327037 (WNT4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100327037 (WNT4)
   05205 Proteoglycans in cancer
    100327037 (WNT4)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100327037 (WNT4)
   05226 Gastric cancer
    100327037 (WNT4)
   05217 Basal cell carcinoma
    100327037 (WNT4)
   05224 Breast cancer
    100327037 (WNT4)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100327037 (WNT4)
   05022 Pathways of neurodegeneration - multiple diseases
    100327037 (WNT4)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100327037 (WNT4)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100327037 (WNT4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:ssc00536]
    100327037 (WNT4)
Glycosaminoglycan binding proteins [BR:ssc00536]
 Heparan sulfate / Heparin
  Morphogens
   100327037 (WNT4)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 100327037
NCBI-ProteinID: NP_001164299
Ensembl: ENSSSCG00000003521
UniProt: D3JCV7
LinkDB
Position
6
AA seq 417 aa
MCKRNLEVMDSVRRGAQLAIEECQYQFRNRRWNCSTLDSLPVFGKVVTQGTREAAFVYAI
SSAGVAFAVTRACSSGELEKCGCDRTVHGVSPQGFQWSGCSDNIAYGVAFSQSFVDVRER
SKGASSSRALMNLHNNEAGRKAILTHMRVECKCHGVSGSCEVKTCWRACRPSARWATHSR
RSLTVPPRWSHAVWAPPGRWCRATRSSSRIQMRTWCTWSPARTSASRTCAAACWAQGAAR
ATRRPRPLTAVSCCAVAAASTQHRWSWPSAAAANSTGAASSSAGSASGWWSCTRAGDRRL
GLRPQPPSGPGKADNLNSPHHPPQKILVVFFVLVWFLGPHVIYCQNQAGDPSSTDWGLPK
AWVFVAATDQRDLAHASGCPHVDAADHSVAICNRFSTCRLEVGNEECYSHMPTGPAS
NT seq 1254 nt   +upstreamnt  +downstreamnt
atgtgcaagcggaacctggaggtgatggactcggtgcgccgcggcgcccagctcgccatt
gaagagtgccagtaccagttccggaaccggcgctggaactgctccaccctcgactcgctg
cctgtcttcggcaaggtggtgacacaagggacccgggaggcggccttcgtgtacgccatc
tcttcagcaggtgtggcctttgcggtgacacgggcgtgcagcagcggggagctggagaag
tgcggctgtgaccggacggtccacggggtcagcccacaaggcttccagtggtcaggatgc
tcggacaacatcgcgtacggtgtggccttctcacagtcgtttgtggacgtgcgggagaga
agcaagggggcctcgtccagccgggccctcatgaacctccacaacaatgaggccggcagg
aaggctatcctgacacacatgcgggtggagtgcaagtgccatggggtgtcgggctcctgc
gaggtaaagacgtgctggcgagcctgccgcccttccgccaggtgggccacgcactcaagg
agaagtttgacggtgccaccgaggtggagccacgccgtgtgggctcctccagggcgctgg
tgccgcgcaacgcgcagttcaagccgcatacagatgaggacttggtgtacttggagccca
gcccggacttctgcgagcaggacatgcgcagcggcgtgctgggcacaaggggccgcacgt
gcaacaagacgtccaaggccattgacggctgtgagctgctgtgctgtggccgcggcttcc
acacagcacaggtggagctggccgagcgctgcagctgcaaattccactggtgctgcttcg
tcaagtgccggcagtgccagcggctggtggagctgcacacgtgccggtgaccgccgcctg
ggcctacgcccacaaccacctagtggcccggggaaggccgataatttaaacagtccccac
cacccaccccaaaagatactggttgtattttttgttttggtttggtttttgggtcctcat
gttatttattgccaaaaccaggcaggggaccccagcagcactgactggggcctccctaaa
gcctgggtctttgtggctgccactgaccaaagggaccttgctcatgcctctggctgtcca
catgtggacgctgctgaccactcagttgctatctgtaaccgtttttccacttgcagactt
gaggtgggtaacgaagagtgttacagccacatgcctactggccctgccagctag

KEGG   Sus scrofa (pig): 100511484
Entry
100511484         CDS       T01009                                 

Gene name
WNT16
Definition
(RefSeq) protein Wnt-16
  KO
K01558  wingless-type MMTV integration site family, member 16
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04150  mTOR signaling pathway
ssc04310  Wnt signaling pathway
ssc04390  Hippo signaling pathway
ssc04550  Signaling pathways regulating pluripotency of stem cells
ssc04916  Melanogenesis
ssc04934  Cushing syndrome
ssc05010  Alzheimer disease
ssc05022  Pathways of neurodegeneration - multiple diseases
ssc05165  Human papillomavirus infection
ssc05200  Pathways in cancer
ssc05202  Transcriptional misregulation in cancer
ssc05205  Proteoglycans in cancer
ssc05217  Basal cell carcinoma
ssc05224  Breast cancer
ssc05225  Hepatocellular carcinoma
ssc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100511484 (WNT16)
   04390 Hippo signaling pathway
    100511484 (WNT16)
   04150 mTOR signaling pathway
    100511484 (WNT16)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100511484 (WNT16)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100511484 (WNT16)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100511484 (WNT16)
   05202 Transcriptional misregulation in cancer
    100511484 (WNT16)
   05205 Proteoglycans in cancer
    100511484 (WNT16)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100511484 (WNT16)
   05226 Gastric cancer
    100511484 (WNT16)
   05217 Basal cell carcinoma
    100511484 (WNT16)
   05224 Breast cancer
    100511484 (WNT16)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100511484 (WNT16)
   05022 Pathways of neurodegeneration - multiple diseases
    100511484 (WNT16)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100511484 (WNT16)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100511484 (WNT16)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:ssc00536]
    100511484 (WNT16)
Glycosaminoglycan binding proteins [BR:ssc00536]
 Heparan sulfate / Heparin
  Morphogens
   100511484 (WNT16)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 100511484
NCBI-ProteinID: XP_003134784
Ensembl: ENSSSCG00000016617
UniProt: F1SJF8
LinkDB
Position
18
AA seq 362 aa
MDRAALLGLSRLCALWAALLALFPCGAQGNWMWLGIASFGVPEKLGCANLPLNSRQKELC
KRKPYLLPSIREGARLGIQECRSQFKHERWNCLVATASQQGTSPLFGYELSSGTKETAFI
YAVMAAGLVHSVTRSCSAGNMTECSCDTTLQNGGSASEGWHWGGCSDDVQYGMWFSRRFL
DFPIRNTTGKESKVLLAMNLHNNEAGRQAVAKLMSLDCRCHGVSGSCAVKTCWKTMSSFE
KIGHLLKDKYENSVQISDKIKKKMLRRDKDQRKIPIRKDDLLYVNKSPNYCVEDKKLGIP
GTQGRECNRTSEGADGCNLLCCGRGYNTHVVRHVERCECKFIWCCYVRCRRCESMTDVHT
CK
NT seq 1089 nt   +upstreamnt  +downstreamnt
atggacagagcagcgctcctgggactgtcccgcctgtgcgcgctgtgggcagccctgctc
gcgctgtttccctgcggagcccaaggaaactggatgtggttgggcatcgcctcctttggg
gttccggagaagctgggctgcgccaacttgccgctgaacagccgccagaaggagctgtgc
aagaggaaaccgtacctgctgccgagcatccgcgagggtgcccgcctgggcatccaggaa
tgcaggagccagttcaaacatgagagatggaactgcctggtggccaccgcctcccagcag
ggcaccagccccctcttcggctacgagctgagcagcggcaccaaggaaacagcatttatt
tatgctgtgatggctgcaggcctggtgcattctgtgaccaggtcatgtagtgcaggcaac
atgacggagtgttcctgtgacaccaccttgcagaatggcggctcagcgagtgaaggctgg
cactgggggggctgctctgatgatgttcagtatggcatgtggttcagcagaaggttccta
gatttccccatcagaaacaccacgggaaaagagagcaaagtactgttagcaatgaaccta
cataacaatgaagctggaaggcaggctgtcgccaagctgatgtcactagactgccggtgt
cacggagtttccggctcctgtgctgtgaaaacgtgttggaaaaccatgtcttcttttgaa
aagattggccatctgttgaaggacaaatacgaaaacagcgtccaaatctcagacaagata
aagaagaaaatgctcaggagagacaaagatcagaggaaaatacccatccgcaaggatgat
ctgctctacgttaataaatctcccaattactgtgtagaggataagaaactagggatccca
gggacccagggcagggagtgcaaccgcacctcagagggtgcggatggctgtaaccttctc
tgctgtggcagaggctacaacacccacgtggtcaggcacgtggagagatgcgagtgcaag
tttatctggtgctgctacgtccgttgcaggaggtgtgaaagcatgactgacgtccacact
tgcaagtag

KEGG   Sus scrofa (pig): 100512949
Entry
100512949         CDS       T01009                                 

Gene name
WNT9A
Definition
(RefSeq) protein Wnt-9a
  KO
K01064  wingless-type MMTV integration site family, member 9
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04150  mTOR signaling pathway
ssc04310  Wnt signaling pathway
ssc04390  Hippo signaling pathway
ssc04550  Signaling pathways regulating pluripotency of stem cells
ssc04916  Melanogenesis
ssc04934  Cushing syndrome
ssc05010  Alzheimer disease
ssc05022  Pathways of neurodegeneration - multiple diseases
ssc05165  Human papillomavirus infection
ssc05200  Pathways in cancer
ssc05205  Proteoglycans in cancer
ssc05217  Basal cell carcinoma
ssc05224  Breast cancer
ssc05225  Hepatocellular carcinoma
ssc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100512949 (WNT9A)
   04390 Hippo signaling pathway
    100512949 (WNT9A)
   04150 mTOR signaling pathway
    100512949 (WNT9A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100512949 (WNT9A)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100512949 (WNT9A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100512949 (WNT9A)
   05205 Proteoglycans in cancer
    100512949 (WNT9A)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100512949 (WNT9A)
   05226 Gastric cancer
    100512949 (WNT9A)
   05217 Basal cell carcinoma
    100512949 (WNT9A)
   05224 Breast cancer
    100512949 (WNT9A)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100512949 (WNT9A)
   05022 Pathways of neurodegeneration - multiple diseases
    100512949 (WNT9A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100512949 (WNT9A)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100512949 (WNT9A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:ssc00536]
    100512949 (WNT9A)
Glycosaminoglycan binding proteins [BR:ssc00536]
 Heparan sulfate / Heparin
  Morphogens
   100512949 (WNT9A)
SSDB
Motif
Pfam: wnt Clr5
Other DBs
NCBI-GeneID: 100512949
NCBI-ProteinID: XP_003123659
Ensembl: ENSSSCG00000024671
UniProt: I3LTN8 A0A4X1UJI2
LinkDB
Position
2
AA seq 365 aa
MLDGPLLARWLAAAFALTLLLAALRPSAAYFGLTGSEPLTILPLTLEPEAAAQAHYKACD
RLKLERKQRRMCRRDPGVAETLVEAVSMSALECQYQFRFERWNCTLEGRYRASLLKRGFK
ETAFLYAISSAGLTHALAKACSAGRMERCTCDEAPDLENREAWQWGGCGDNLKYSSKFVK
EFLGRRSSKDLRARVDFHNNLVGVKVIKAGVETTCKCHGVSGSCTVRTCWRQLAPFHEVG
KRLKHKYETALKVGSTTNEATGEAGAISPPRGRAMGTGGGDPLPRTPDLVHLDDSPSFCL
AGRFSPGTAGRRCHREKNCESICCGRGHNTQSRVVTRPCQCQVRWCCYVECRQCTQREEV
YTCKG
NT seq 1098 nt   +upstreamnt  +downstreamnt
atgctggatgggcccctgctggcgcgctggctggccgcggccttcgcgctgactctgctg
cttgccgcgctgcgcccctcggccgcctacttcgggctgacgggcagtgagcccctgacc
atcctcccactgaccctggagccagaagcagctgcccaggcacactacaaggcttgtgac
cggctgaagctggagcgcaagcagcggcgcatgtgccgccgggaccctggtgtggctgag
acgctggtggaggcagtcagcatgagtgctcttgagtgccagtaccagttccggtttgaa
cgctggaactgcaccttggagggccgctaccgggccagcctgcttaagcgaggcttcaag
gagacagccttcctctacgccatctcctcagctggcctgacacatgcactggccaaggca
tgcagtgcaggccgcatggaacgctgcacttgcgatgaggcccctgacctggagaaccga
gaggcctggcagtggggtggctgtggggataatctcaagtacagcagcaagtttgtaaag
gagttcctgggtcggcggtctagcaaggatctgcgagcccgtgtggacttccataacaac
ctcgtgggtgtgaaggtgatcaaggctggggtggagaccacgtgcaagtgtcatggtgtg
tcgggctcatgcaccgtgaggacgtgctggcggcagctggcacctttccacgaggtgggc
aagcgcctgaagcacaagtatgagacagcgctcaaggtgggcagcaccaccaatgaggcc
actggggaggctggtgccatctcaccaccacggggccgggccatggggacaggtggtggt
gacccactgccccgcaccccagacctagtgcacctggatgactcacccagcttctgcctg
gctggccgcttctccccaggcactgctggccgcaggtgccaccgggagaagaactgcgag
agcatctgctgtgggcgcggtcacaacacacagagcagggtggtgacccgcccttgccag
tgccaggtgcgctggtgctgctacgtggagtgcaggcagtgcacccagcgtgaggaggtc
tatacctgtaagggctga

KEGG   Sus scrofa (pig): 100513655
Entry
100513655         CDS       T01009                                 

Gene name
WNT8B
Definition
(RefSeq) protein Wnt-8b isoform X1
  KO
K00714  wingless-type MMTV integration site family, member 8
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04150  mTOR signaling pathway
ssc04310  Wnt signaling pathway
ssc04390  Hippo signaling pathway
ssc04550  Signaling pathways regulating pluripotency of stem cells
ssc04916  Melanogenesis
ssc04934  Cushing syndrome
ssc05010  Alzheimer disease
ssc05022  Pathways of neurodegeneration - multiple diseases
ssc05165  Human papillomavirus infection
ssc05200  Pathways in cancer
ssc05205  Proteoglycans in cancer
ssc05217  Basal cell carcinoma
ssc05224  Breast cancer
ssc05225  Hepatocellular carcinoma
ssc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100513655 (WNT8B)
   04390 Hippo signaling pathway
    100513655 (WNT8B)
   04150 mTOR signaling pathway
    100513655 (WNT8B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100513655 (WNT8B)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100513655 (WNT8B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100513655 (WNT8B)
   05205 Proteoglycans in cancer
    100513655 (WNT8B)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100513655 (WNT8B)
   05226 Gastric cancer
    100513655 (WNT8B)
   05217 Basal cell carcinoma
    100513655 (WNT8B)
   05224 Breast cancer
    100513655 (WNT8B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100513655 (WNT8B)
   05022 Pathways of neurodegeneration - multiple diseases
    100513655 (WNT8B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100513655 (WNT8B)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100513655 (WNT8B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:ssc00536]
    100513655 (WNT8B)
Glycosaminoglycan binding proteins [BR:ssc00536]
 Heparan sulfate / Heparin
  Morphogens
   100513655 (WNT8B)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 100513655
NCBI-ProteinID: XP_003125637
Ensembl: ENSSSCG00000006164
UniProt: A0A4X1TZ80 F1RWL9
LinkDB
Position
14
AA seq 351 aa
MLLMKPSVCIFLFTCVLQLSHTWSVNNFLMTGPKAYLIYSSSVAAGAQSGIEECKYQFAW
DRWNCPERALQLSSHGGLRSANRETAFVHAISSAGVMYTLTRNCSLGDFDNCGCDDSRNG
QLGGQGWLWGGCSDNVGFGEAISKQFVDALETGQDARAAMNLHNNEAGRKAVKGTMKRTC
KCHGVSGSCTTQTCWLQLPEFREVGAHLKEKYHAALKVDLLQGAGNSAAGRGAIADTFRS
ISTRELVHLEDSPDYCLENKTLGLLGTEGRECLRRGRALGRWERRSCRRLCGDCGLSVEE
RRAETVSSCNCKFHWCCAVRCEQCRRRVTKYFCSRAERPPGGAAHKPGRKP
NT seq 1056 nt   +upstreamnt  +downstreamnt
atgttgcttatgaagccttctgtgtgcatctttctttttacctgtgtcctccaactcagc
cacacctggtcagtgaacaatttcctgatgactggtccaaaggcttacctgatctactcc
agcagtgtagctgctggcgctcagagtggcattgaagaatgcaaataccagtttgcatgg
gatcgctggaactgccctgagagagccctgcagctgtccagccatggtggacttcgaagt
gctaatcgggaaacggcattcgtgcatgctatcagttctgctggggtcatgtacactctg
actagaaactgcagccttggggattttgacaattgtggctgtgatgattcccgcaatggg
caactggggggccaaggctggctgtggggaggctgcagcgacaacgtgggcttcggagag
gcaatatccaaacagttcgtagatgccctggagacaggacaggatgcccgggcagccatg
aatctacacaacaacgaggctggtcgcaaggcagtaaagggcaccatgaaacgcacatgt
aaatgccacggcgtttctggcagctgcaccacgcagacctgctggctgcagttgcccgag
ttccgagaggtgggcgcgcacttgaaagagaagtaccacgcagctctcaaggtggatctg
ctgcagggtgctggcaacagcgcggcgggccgcggcgccatcgccgacacctttcgctcc
atctccacgcgggagctggtgcacctggaggactccccggactactgcctggagaacaaa
actctaggactgctgggcaccgaaggcagagagtgcctgcggcgcggccgggccctgggc
cgctgggagcgtcgcagctgccgtcggctctgcggcgactgcggcctgtcggtggaggag
cgccgcgcggagacagtgtccagctgcaactgcaagttccactggtgctgcgcggtccgc
tgcgagcagtgccgccggcgggttaccaaatacttctgcagtcgcgcggagcggccgccg
gggggcgcggctcacaaacctgggagaaaaccctaa

KEGG   Sus scrofa (pig): 100514950
Entry
100514950         CDS       T01009                                 

Gene name
WNT3A
Definition
(RefSeq) protein Wnt-3a isoform X1
  KO
K00312  wingless-type MMTV integration site family, member 3
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04150  mTOR signaling pathway
ssc04310  Wnt signaling pathway
ssc04390  Hippo signaling pathway
ssc04550  Signaling pathways regulating pluripotency of stem cells
ssc04916  Melanogenesis
ssc04934  Cushing syndrome
ssc05010  Alzheimer disease
ssc05022  Pathways of neurodegeneration - multiple diseases
ssc05165  Human papillomavirus infection
ssc05200  Pathways in cancer
ssc05205  Proteoglycans in cancer
ssc05206  MicroRNAs in cancer
ssc05217  Basal cell carcinoma
ssc05224  Breast cancer
ssc05225  Hepatocellular carcinoma
ssc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100514950 (WNT3A)
   04390 Hippo signaling pathway
    100514950 (WNT3A)
   04150 mTOR signaling pathway
    100514950 (WNT3A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100514950 (WNT3A)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100514950 (WNT3A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100514950 (WNT3A)
   05206 MicroRNAs in cancer
    100514950 (WNT3A)
   05205 Proteoglycans in cancer
    100514950 (WNT3A)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100514950 (WNT3A)
   05226 Gastric cancer
    100514950 (WNT3A)
   05217 Basal cell carcinoma
    100514950 (WNT3A)
   05224 Breast cancer
    100514950 (WNT3A)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100514950 (WNT3A)
   05022 Pathways of neurodegeneration - multiple diseases
    100514950 (WNT3A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100514950 (WNT3A)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100514950 (WNT3A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:ssc00536]
    100514950 (WNT3A)
Glycosaminoglycan binding proteins [BR:ssc00536]
 Heparan sulfate / Heparin
  Morphogens
   100514950 (WNT3A)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 100514950
NCBI-ProteinID: XP_003123669
UniProt: A0A480RFN3
LinkDB
Position
2
AA seq 352 aa
MAPLGYFIFLYGLKQALGSYPIWWSLAVGPQYSSLGTQPILCASIPGLVPKQLRFCRNYV
EIMPSVAEGIKISIQECQHQFRGRRWNCTTINNSLAIFGPVLDKATRESAFVHAIASAGV
AFAVTRSCAEGSAAICGCSSRHQGSPGEGWKWGGCSEDIEFGGMVSREFADARENRPDAR
SAMNRHNNEAGRQAIASHMHLKCKCHGLSGSCEVKTCWWSQPDFRAIGDFLKDKYDSASE
MVVEKHRESRGWVETLRPRYTYFKVPTERDLVYYEASPNFCEPNPETGSFGTRDRTCNVS
SHGIDGCDLLCCGRGHNARTERRREKCHCVFHWCCYVSCQECTRIYDVHTCK
NT seq 1059 nt   +upstreamnt  +downstreamnt
atggcccctcttggatatttcatattcctctacggcctgaagcaagctctgggcagctac
ccgatctggtggtccctggctgttgggccccagtactcatccctggggacacagcccatc
ctctgcgccagtatcccaggcctggtacccaagcagctgcgtttctgccggaactatgtg
gagatcatgcccagcgtggcagagggcatcaagatcagcatccaagagtgccaacaccag
ttccgtggccgccggtggaattgcaccactatcaacaacagcctggccatctttggcccc
gtgctggacaaagccacccgggagtctgccttcgtgcacgctatcgcctccgctggagtt
gccttcgctgtgactcgctcgtgtgcggagggctccgctgccatctgcggctgcagcagc
cgtcaccagggctctcccggtgagggctggaagtggggcgggtgcagcgaggacattgag
ttcggcgggatggtgtctcgggagttcgcagatgcgcgggagaaccggccagacgctcgc
tccgcaatgaaccgtcacaacaatgaggctgggcgccaggccatcgccagccacatgcac
ctcaagtgcaagtgccatgggctgtcaggcagctgtgaggtgaagacctgctggtggtcg
cagcctgacttccgtgccattggcgacttcctcaaggacaagtacgacagcgcctctgag
atggtggtggagaagcaccgcgagtcacgtggctgggtggagaccctgcggccacgctac
acctactttaaggtgcccacagagcgcgacttggtctactatgaggcctcacccaacttc
tgtgaacccaaccccgagacgggatccttcggtacacgtgaccgcacctgcaacgtgagc
tcacatggcattgatggctgtgacctgctgtgctgcggccgaggccacaacgcacgcact
gagaggcggagggagaagtgccactgtgtcttccactggtgctgttacgtgagctgccag
gagtgcacgcgcatctacgacgtgcacacctgcaagtag

KEGG   Sus scrofa (pig): 100516268
Entry
100516268         CDS       T01009                                 

Gene name
WNT5B
Definition
(RefSeq) LOW QUALITY PROTEIN: protein Wnt-5b
  KO
K00444  wingless-type MMTV integration site family, member 5
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04150  mTOR signaling pathway
ssc04310  Wnt signaling pathway
ssc04360  Axon guidance
ssc04390  Hippo signaling pathway
ssc04550  Signaling pathways regulating pluripotency of stem cells
ssc04916  Melanogenesis
ssc04934  Cushing syndrome
ssc05010  Alzheimer disease
ssc05022  Pathways of neurodegeneration - multiple diseases
ssc05165  Human papillomavirus infection
ssc05200  Pathways in cancer
ssc05205  Proteoglycans in cancer
ssc05217  Basal cell carcinoma
ssc05224  Breast cancer
ssc05225  Hepatocellular carcinoma
ssc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100516268 (WNT5B)
   04390 Hippo signaling pathway
    100516268 (WNT5B)
   04150 mTOR signaling pathway
    100516268 (WNT5B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100516268 (WNT5B)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100516268 (WNT5B)
  09158 Development and regeneration
   04360 Axon guidance
    100516268 (WNT5B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100516268 (WNT5B)
   05205 Proteoglycans in cancer
    100516268 (WNT5B)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100516268 (WNT5B)
   05226 Gastric cancer
    100516268 (WNT5B)
   05217 Basal cell carcinoma
    100516268 (WNT5B)
   05224 Breast cancer
    100516268 (WNT5B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100516268 (WNT5B)
   05022 Pathways of neurodegeneration - multiple diseases
    100516268 (WNT5B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100516268 (WNT5B)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100516268 (WNT5B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:ssc00536]
    100516268 (WNT5B)
Glycosaminoglycan binding proteins [BR:ssc00536]
 Heparan sulfate / Heparin
  Morphogens
   100516268 (WNT5B)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 100516268
NCBI-ProteinID: XP_020948157
LinkDB
Position
5
AA seq 361 aa
MPSPPLLLAAAAALLASWAPLPSEASSWWSLAMNPVQRPEMFIIGAQPVCSQLPGLSPGQ
RKLCQLYQEHMAYIGEGARTGIKECQHQFRQRRWNCSTVGNASVFGRVVQIGSRETAFTY
XVSAAGVVNAISRACREGELSTCGCSRXARPKDLPRDWLWGGCGDNVEYGYRFAKEFVDA
REREKNFAKGSEEQGRVLMNLQNNEAGRRAVYKMADVACKCHGVSGSCSLKTCWLQLAEF
RKVGDQLKEKYDSAAAMRITRRGKLELVNSRFNQPTPEDLVYVDPSPDYCLRNESTGSLG
TQGRLCNKTSEGMDGCALMCCGRGYDQFKSVQVERCHCKFHWCCFVRCKKCTEVVDQFVC
K
NT seq 1086 nt   +upstreamnt  +downstreamnt
atgcccagcccgccactcctgctcgccgctgctgcagccctgctcgccagctgggccccg
ctcccctctgaggccagctcctggtggtccttggccatgaacccggtgcagagacctgag
atgttcatcatcggagcccagcccgtgtgcagccagctccctgggctgtcccccggccag
aggaagctgtgccagctttaccaggagcacatggcctacataggggagggggccaggaca
ggcatcaaggagtgtcagcaccagttccggcagcgacggtggaattgcagcaccgtgggc
aatgcctctgtctttggaagggtcgtgcagatagggagccgggagacggccttcacctac
ngcgtgagcgctgccggggttgtgaacgccatcagccgcgcctgccgcgagggcgagctg
tccacgtgcggctgcagccggngcgcacggcccaaggacctgccgcgggactggctgtgg
ggcggctgcggggacaacgtggagtacggctaccgcttcgccaaggagtttgtggacgcc
cgcgagcgggagaagaactttgccaaggggtcggaggagcagggccgcgtgctcatgaac
ctgcagaacaacgaggcaggccgaagggctgtgtataagatggcagacgtagcctgcaaa
tgccatggcgtttcggggtcctgcagcctcaagacctgctggctgcagctggctgagttc
cgcaaggtgggggaccagctgaaggagaagtatgacagcgcagccgccatgcgcatcacc
cgcaggggcaagttggagctggtcaacagccgcttcaaccagcccacccccgaggacctg
gtctacgtggaccccagcccggactactgcctgcgcaacgagagcacaggctcgctgggc
acgcagggccgcctgtgcaacaagacatcggagggcatggacggctgcgcgctcatgtgc
tgcggccgtggctatgaccagttcaagagcgtgcaggtggagcgctgccactgcaagttc
cactggtgctgcttcgtcaggtgcaagaagtgcacggaagttgtggaccagtttgtctgc
aagtag

KEGG   Sus scrofa (pig): 100516839
Entry
100516839         CDS       T01009                                 

Gene name
WNT2
Definition
(RefSeq) protein Wnt-2
  KO
K00182  wingless-type MMTV integration site family, member 2
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04150  mTOR signaling pathway
ssc04310  Wnt signaling pathway
ssc04390  Hippo signaling pathway
ssc04550  Signaling pathways regulating pluripotency of stem cells
ssc04916  Melanogenesis
ssc04934  Cushing syndrome
ssc05010  Alzheimer disease
ssc05022  Pathways of neurodegeneration - multiple diseases
ssc05165  Human papillomavirus infection
ssc05200  Pathways in cancer
ssc05205  Proteoglycans in cancer
ssc05217  Basal cell carcinoma
ssc05224  Breast cancer
ssc05225  Hepatocellular carcinoma
ssc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100516839 (WNT2)
   04390 Hippo signaling pathway
    100516839 (WNT2)
   04150 mTOR signaling pathway
    100516839 (WNT2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100516839 (WNT2)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100516839 (WNT2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100516839 (WNT2)
   05205 Proteoglycans in cancer
    100516839 (WNT2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100516839 (WNT2)
   05226 Gastric cancer
    100516839 (WNT2)
   05217 Basal cell carcinoma
    100516839 (WNT2)
   05224 Breast cancer
    100516839 (WNT2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100516839 (WNT2)
   05022 Pathways of neurodegeneration - multiple diseases
    100516839 (WNT2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100516839 (WNT2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100516839 (WNT2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:ssc00536]
    100516839 (WNT2)
Glycosaminoglycan binding proteins [BR:ssc00536]
 Heparan sulfate / Heparin
  Morphogens
   100516839 (WNT2)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 100516839
NCBI-ProteinID: XP_003134804
Ensembl: ENSSSCG00000016628
UniProt: A0A287B4Y7 A0A4X1W5H1
LinkDB
Position
18
AA seq 360 aa
MNACLGGIWLWLPLLLTWLSPEVSSSWWYMRATGGSSRVMCDNVPGLVSRQRQLCHRHPD
VMRAISLGVAEWTAECQHQFRQHRWNCNTLDRDHSLFGRVLLRSSRESAFVYAISSAGVV
FAITRACSQGELKSCSCDPKKKGTAKDSKGTFDWGGCSDNIDYGIKFARAFVDAKERKGK
DARALMNLHNNRAGRKAVKRFLKQECKCHGVSGSCTLRTCWLAMADFRKTGDYLWRKYNG
AIQVVMNQDGTGFTVANKRFKKPTKNDLVYFENSPDYCIRDRDAGSLGTAGRVCNLTSRG
MDSCEVMCCGRGYDTSRVTRMTKCECKFHWCCAVRCQDCLEALDVHTCKAPKSADWAAPT
NT seq 1083 nt   +upstreamnt  +downstreamnt
atgaacgcctgtctcggtggaatctggctctggctccctctgctcttgacctggctcagc
cctgaggtcagctcttcatggtggtacatgagagccacaggcggctcctccagggtgatg
tgtgacaacgtgccagggctggtgagccgtcagcggcagctgtgccaccgacatccagac
gtgatgcgtgccatcagcctgggcgtggctgagtggacagctgagtgccaacaccaattc
cgccagcaccgctggaactgcaacaccctggacagggatcacagcctcttcggcagggtc
ctgcttcgaagtagccgggaatctgcctttgtgtacgccatctcctcagctggagttgta
tttgccatcaccagggcctgtagccaaggagaattaaagtcctgttcctgtgacccgaag
aagaagggaacagccaaggacagcaagggcaccttcgactggggtggctgcagtgacaac
attgactatgggatcaagtttgcccgagcatttgtggacgccaaggaaaggaaaggaaag
gacgccagagccctgatgaatcttcacaacaacagagccggcaggaaggctgtaaagcgg
ttcctgaaacaggagtgcaagtgccatggcgtgagcggctcctgtaccctgaggacctgc
tggctggccatggccgacttcaggaaaacaggcgattacctctggaggaagtacaacggg
gccatccaggttgtcatgaatcaggatggcacgggtttcactgtggctaacaagaggttt
aaaaagcccacgaaaaatgacctcgtatattttgagaattctccagactactgtatcagg
gaccgagatgcaggctccctgggtacagcaggtcgtgtgtgcaacctgacttcccgaggc
atggacagctgtgaagtcatgtgctgtgggagaggctatgacacctcccgagtcactcgg
atgaccaagtgcgagtgtaagttccactggtgctgtgccgtgcgctgccaggactgcctg
gaggccctggatgtgcacacatgcaaggccccaaagagcgccgactgggcggctcccaca
tga

KEGG   Sus scrofa (pig): 100519512
Entry
100519512         CDS       T01009                                 

Gene name
WNT3
Definition
(RefSeq) proto-oncogene Wnt-3 isoform X1
  KO
K00312  wingless-type MMTV integration site family, member 3
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04150  mTOR signaling pathway
ssc04310  Wnt signaling pathway
ssc04390  Hippo signaling pathway
ssc04550  Signaling pathways regulating pluripotency of stem cells
ssc04916  Melanogenesis
ssc04934  Cushing syndrome
ssc05010  Alzheimer disease
ssc05022  Pathways of neurodegeneration - multiple diseases
ssc05165  Human papillomavirus infection
ssc05200  Pathways in cancer
ssc05205  Proteoglycans in cancer
ssc05206  MicroRNAs in cancer
ssc05217  Basal cell carcinoma
ssc05224  Breast cancer
ssc05225  Hepatocellular carcinoma
ssc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100519512 (WNT3)
   04390 Hippo signaling pathway
    100519512 (WNT3)
   04150 mTOR signaling pathway
    100519512 (WNT3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100519512 (WNT3)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100519512 (WNT3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100519512 (WNT3)
   05206 MicroRNAs in cancer
    100519512 (WNT3)
   05205 Proteoglycans in cancer
    100519512 (WNT3)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100519512 (WNT3)
   05226 Gastric cancer
    100519512 (WNT3)
   05217 Basal cell carcinoma
    100519512 (WNT3)
   05224 Breast cancer
    100519512 (WNT3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100519512 (WNT3)
   05022 Pathways of neurodegeneration - multiple diseases
    100519512 (WNT3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100519512 (WNT3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100519512 (WNT3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:ssc00536]
    100519512 (WNT3)
Glycosaminoglycan binding proteins [BR:ssc00536]
 Heparan sulfate / Heparin
  Morphogens
   100519512 (WNT3)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 100519512
NCBI-ProteinID: XP_013836319
Ensembl: ENSSSCG00000017317
LinkDB
Position
12
AA seq 453 aa
MPFPEPDSWAGREGRVIDRLNYRLISYLRPRALIGCSLTSSNPAAPRWAREGGRCGWRCA
SDKPESHFQSQVDFVPTIGGVAPPLHGRGQTSSSALLLMEPHLLGLLLGLLLCGTRVLAG
YPIWWSLALGQQYTSLGSQPLLCGSIPGLVPKQLRFCRNYIEIMPSVAEGVKLGIQECQH
QFRGRRWNCTTIDDSLAIFGPVLDKATRESAFVHAIASAGVAFAVTRSCAEGTSTICGCD
SHHKGPPGEGWKWGGCSEDADFGVLVSREFADARENRPDARSAMNKHNNEAGRTTILDHM
HLKCKCHGLSGSCEVKTCWWAQPDFRAIGDFLKDKYDSASEMVVEKHRESRGWVETLRAK
YALFKPPTERDLVYYENSPNFCEPNPETGSFGTRDRTCNVTSHGIDGCDLLCCGRGHNTR
TEKRKEKCHCIFHWCCYVSCQECIRIYDVHTCK
NT seq 1362 nt   +upstreamnt  +downstreamnt
atgcccttcccggagcccgactcgtgggccgggcgggaggggcgcgtgattgacaggctg
aactacagactcatctcttaccttaggccgcgggcgctgattggctgctcgctgacatcc
tcaaacccggctgctccgcgctgggctcgggaggggggccgctgcgggtggaggtgcgct
tctgacaagcccgaaagtcatttccaatctcaagtggactttgttccaactattgggggc
gtcgctccccctcttcatggtcgcgggcaaacttcctcctcggcgctgcttctaatggag
ccccacctgctcgggctgctcctcggcctcctgctctgtggcaccagggtcctcgccggc
tacccaatttggtggtccctggccctgggccagcagtacacatccctgggctcacagcct
ctgctctgcggctccatcccaggcctggtccccaagcaactgcgcttctgccgaaattac
attgaaatcatgcccagtgtggctgaaggtgtgaagttgggcatccaggagtgccagcac
cagttccggggccgccgctggaactgcaccaccattgatgacagcctcgccatcttcggg
cccgttcttgacaaagccacccgcgaatcggccttcgtgcacgccatcgcctctgctggt
gtggcctttgctgtcacgcgatcctgtgcggagggcacctccaccatctgtggctgtgat
tcgcatcataaggggccgcccggcgagggctggaagtggggcggctgcagcgaggatgcc
gacttcggggtgcttgtgtcccgggagttcgcagacgcacgtgagaataggccggatgcg
cgctcggccatgaacaagcacaacaacgaggctggccgcacgaccatcctggaccacatg
cacctcaagtgcaagtgccatgggctgtcgggcagttgcgaggtcaagacctgctggtgg
gcccagcccgacttccgtgccatcggcgacttccttaaggacaagtacgacagtgcctcg
gagatggtggtggagaagcaccgtgagtcccgcggctgggtggagaccctccgcgccaag
tacgcgctcttcaagccacccaccgagagggacctggtctactacgagaactcccccaac
ttttgtgagcccaacccggagacgggctcctttggcaccagggaccggacttgcaatgtc
acctcccacggcatcgatggctgtgacctgctctgctgcggccgtggccacaacacaagg
acggagaagcggaaggagaaatgccactgcatcttccactggtgctgctacgtgagctgc
caggagtgtatccgcatctacgatgtgcacacctgcaagtag

KEGG   Sus scrofa (pig): 100520560
Entry
100520560         CDS       T01009                                 

Gene name
WNT2B
Definition
(RefSeq) protein Wnt-2b isoform X1
  KO
K00182  wingless-type MMTV integration site family, member 2
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04150  mTOR signaling pathway
ssc04310  Wnt signaling pathway
ssc04390  Hippo signaling pathway
ssc04550  Signaling pathways regulating pluripotency of stem cells
ssc04916  Melanogenesis
ssc04934  Cushing syndrome
ssc05010  Alzheimer disease
ssc05022  Pathways of neurodegeneration - multiple diseases
ssc05165  Human papillomavirus infection
ssc05200  Pathways in cancer
ssc05205  Proteoglycans in cancer
ssc05217  Basal cell carcinoma
ssc05224  Breast cancer
ssc05225  Hepatocellular carcinoma
ssc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100520560 (WNT2B)
   04390 Hippo signaling pathway
    100520560 (WNT2B)
   04150 mTOR signaling pathway
    100520560 (WNT2B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100520560 (WNT2B)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100520560 (WNT2B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100520560 (WNT2B)
   05205 Proteoglycans in cancer
    100520560 (WNT2B)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100520560 (WNT2B)
   05226 Gastric cancer
    100520560 (WNT2B)
   05217 Basal cell carcinoma
    100520560 (WNT2B)
   05224 Breast cancer
    100520560 (WNT2B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100520560 (WNT2B)
   05022 Pathways of neurodegeneration - multiple diseases
    100520560 (WNT2B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100520560 (WNT2B)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100520560 (WNT2B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:ssc00536]
    100520560 (WNT2B)
Glycosaminoglycan binding proteins [BR:ssc00536]
 Heparan sulfate / Heparin
  Morphogens
   100520560 (WNT2B)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 100520560
NCBI-ProteinID: XP_003125897
Ensembl: ENSSSCG00000006780
UniProt: F1SBP6 A0A4X1T8G1
LinkDB
Position
4
AA seq 392 aa
MLRPGGAEKAAQLPPRRARAPVPAPRPTAPDGSRASARLSLACLLLLLLLLTLPARVDTS
WWYIGALGARVICDNIPGLVSRQRQLCQRYPDIMRSVGEGAREWIRECQHQFRHHRWNCT
TLDRDHTVFGRVMLRSSREAAFVYAISSAGVVHAITRACSQGELSVCSCDPYTRGRHHDQ
RGDFDWGGCSDNIHYGVRFAKAFVDAKEKRLKDARALMNLHNNRCGRTAVRRFLKLECKC
HGVSGSCTLRTCWRALSDFRRTGDYLRRRYDGAVQVTATQDGANFTAARQGYRRATRTDL
VYFDNSPDYCVLDKAAGSLGTAGRVCSKTSKGTDGCEIMCCGRGYDTTRVTRVTQCECKF
HWCCAVRCKECRNTVDVHTCKAPKKAEWLDQT
NT seq 1179 nt   +upstreamnt  +downstreamnt
atgctgaggccgggtggtgcggagaaagccgcgcagctgccccctcggcgcgcccgcgcc
ccagtccccgcgcccagacccacggcccccgacggctctcgggcttccgcccgcctaagt
cttgcttgccttctgttgctgctgttgctgctgacgctgccggcccgcgtagacacgtcc
tggtggtacatcggggcactgggggctcgagtgatctgtgacaatattcctggtctggtg
agccggcagcggcaactgtgccagcgttacccagacatcatgcgctcggtgggcgagggt
gcccgagagtggatccgagagtgtcagcaccagttccgccaccatcgctggaactgcacc
accctggaccgggaccacactgtctttggccgtgtcatgctcagaagtagccgggaagca
gcatttgtatacgccatctcatcagcaggggtggtccatgctatcactcgtgcctgtagc
cagggtgaactgagtgtgtgcagctgtgatccttatacccgtggtcgacaccatgaccaa
cgtggggactttgactggggtggctgcagtgacaatatccactatggagttcgctttgcc
aaggcttttgtggatgccaaggagaagaggcttaaggatgccagagctctcatgaactta
cataacaaccgctgtggtcgcacggctgtgcggcgctttctgaagctggagtgtaagtgc
catggcgtgagtggctcctgtactctgcgcacctgctggcgtgcgctctcagacttccgc
cgcacaggtgattacctgcggcggcgctatgatggggctgtgcaggtgacagctacccaa
gatggtgccaacttcacagcagcccgccaaggctatcgccgtgccacccggactgacctt
gtctactttgacaactccccagactactgtgtcttggacaaggctgcaggttccctaggc
actgcaggccgtgtctgcagcaagacatccaaagggacagacggttgtgaaatcatgtgt
tgtggccgagggtatgacacaactcgagttacccgtgtcacccagtgtgagtgcaaattc
cactggtgctgtgctgtgcggtgcaaggagtgcagaaacactgtggacgtccatacttgc
aaagcccctaagaaggcagagtggctggatcagacctga

KEGG   Sus scrofa (pig): 100521912
Entry
100521912         CDS       T01009                                 

Gene name
WNT11
Definition
(RefSeq) protein Wnt-11
  KO
K01384  wingless-type MMTV integration site family, member 11
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04150  mTOR signaling pathway
ssc04310  Wnt signaling pathway
ssc04390  Hippo signaling pathway
ssc04550  Signaling pathways regulating pluripotency of stem cells
ssc04916  Melanogenesis
ssc04934  Cushing syndrome
ssc05010  Alzheimer disease
ssc05022  Pathways of neurodegeneration - multiple diseases
ssc05165  Human papillomavirus infection
ssc05200  Pathways in cancer
ssc05205  Proteoglycans in cancer
ssc05217  Basal cell carcinoma
ssc05224  Breast cancer
ssc05225  Hepatocellular carcinoma
ssc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100521912 (WNT11)
   04390 Hippo signaling pathway
    100521912 (WNT11)
   04150 mTOR signaling pathway
    100521912 (WNT11)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100521912 (WNT11)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100521912 (WNT11)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100521912 (WNT11)
   05205 Proteoglycans in cancer
    100521912 (WNT11)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100521912 (WNT11)
   05226 Gastric cancer
    100521912 (WNT11)
   05217 Basal cell carcinoma
    100521912 (WNT11)
   05224 Breast cancer
    100521912 (WNT11)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100521912 (WNT11)
   05022 Pathways of neurodegeneration - multiple diseases
    100521912 (WNT11)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100521912 (WNT11)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100521912 (WNT11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:ssc00536]
    100521912 (WNT11)
Glycosaminoglycan binding proteins [BR:ssc00536]
 Heparan sulfate / Heparin
  Morphogens
   100521912 (WNT11)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 100521912
NCBI-ProteinID: XP_005667195
Ensembl: ENSSSCG00000022347 ENSSSCG00000026855
UniProt: A0A5G2QZA2
LinkDB
Position
9
AA seq 354 aa
MRARPQVCQALLFALALQTSVCYGIKWLALSKTPAALALNQTQHCKQLEGLVSAQVQLCR
SNLELMHTVVHAAREVMKACRRAFADMRWNCSSIELAPNYLLDLERGTRESAFVYALSAA
AISHAIARACTSGDLPGCSCGPVPGEPPGPGNRWGGCADNLSYGLLMGAKFSDAPMKVKK
TGSQANKLMRLHNSEVGRQALRASLEMKCKCHGVSGSCSIRTCWKGLQELQDVASDLKTR
YLSATKVVHRPMGTRKHLVPKDLDIRPVKDSELVYLQSSPDFCMKNEKVGSHGTQDRQCN
KTSQGSDSCDLMCCGRGYNPYTDRVVERCHCKYHWCCYVTCRRCERTVERYVCK
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgagggcgcggccgcaggtctgccaggcgctgctcttcgccctggcgctccagaccagc
gtgtgctatggcatcaagtggctggcgctgtccaagaccccggcggccctggcgctgaac
cagacgcagcactgcaagcagctggagggcctggtgtctgcgcaggtgcagctgtgccgc
agcaacctggagctcatgcacactgtcgtgcacgccgcccgcgaggtcatgaaggcctgc
cgcagggccttcgccgacatgcgctggaactgctcctccatcgagctcgcccccaactac
ctgcttgacctggagagagggacccgggagtcagccttcgtgtatgcgctgtcggcggcc
gccatcagccacgccatcgcccgggcctgcacctccggcgacctgcccggctgctcctgc
ggccccgtcccaggtgagccacccgggcccgggaaccgctggggaggatgtgcggacaac
ctcagctacgggctcctcatgggggccaagttttccgatgctcctatgaaggtgaaaaaa
acaggatcccaagccaataaactgatgcgtctacacaacagtgaagtggggagacaggct
ctgcgcgcctctctggagatgaagtgtaagtgccacggggtgtctggctcctgctccatc
cgcacctgctggaaggggctgcaggagcttcaggatgtggcctcagacctcaagacccgc
tacctgtcggccaccaaggtagtacaccgacccatgggcacccgcaagcacctggtgccc
aaggacctggacatccggcctgtgaaggactcggagctggtctatctgcagagctcccct
gacttctgcatgaagaacgagaaagtgggctcccacgggacgcaggacaggcagtgcaac
aagacatcacaaggcagtgacagctgcgacctcatgtgctgtggacgcggctacaacccc
tacaccgaccgcgtcgtggagcggtgccactgcaagtaccactggtgctgctacgtcacc
tgccgcaggtgcgagcgcaccgtggagcgctacgtctgcaagtga

KEGG   Sus scrofa (pig): 100525462
Entry
100525462         CDS       T01009                                 

Gene name
WNT1
Definition
(RefSeq) proto-oncogene Wnt-1
  KO
K03209  wingless-type MMTV integration site family, member 1
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04150  mTOR signaling pathway
ssc04310  Wnt signaling pathway
ssc04390  Hippo signaling pathway
ssc04550  Signaling pathways regulating pluripotency of stem cells
ssc04916  Melanogenesis
ssc04934  Cushing syndrome
ssc05010  Alzheimer disease
ssc05022  Pathways of neurodegeneration - multiple diseases
ssc05165  Human papillomavirus infection
ssc05200  Pathways in cancer
ssc05205  Proteoglycans in cancer
ssc05217  Basal cell carcinoma
ssc05224  Breast cancer
ssc05225  Hepatocellular carcinoma
ssc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100525462 (WNT1)
   04390 Hippo signaling pathway
    100525462 (WNT1)
   04150 mTOR signaling pathway
    100525462 (WNT1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100525462 (WNT1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100525462 (WNT1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100525462 (WNT1)
   05205 Proteoglycans in cancer
    100525462 (WNT1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100525462 (WNT1)
   05226 Gastric cancer
    100525462 (WNT1)
   05217 Basal cell carcinoma
    100525462 (WNT1)
   05224 Breast cancer
    100525462 (WNT1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100525462 (WNT1)
   05022 Pathways of neurodegeneration - multiple diseases
    100525462 (WNT1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100525462 (WNT1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100525462 (WNT1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:ssc00536]
    100525462 (WNT1)
Glycosaminoglycan binding proteins [BR:ssc00536]
 Heparan sulfate / Heparin
  Morphogens
   100525462 (WNT1)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 100525462
NCBI-ProteinID: XP_003126148
Ensembl: ENSSSCG00000000183
UniProt: A0A4X1WCQ6 F1SJ15
LinkDB
Position
5
AA seq 370 aa
MGHWALLPGWVSATLLLALAALPAALAANSSGRWWGIVNVASSTNLLTDSKSLQLVLEPS
LQLLSRKQRRLIRQNPGILHSVSGGLQSAVRECKWQFRNRRWNCPTASGPHLFGKIVNRG
CRETAFIFAITSAGVTHSVARSCSEGSIESCTCDYRRRGPGGPDWHWGGCSDNIDFGRLF
GREFVDSGEKGRDLRFLMNLHNNEAGRTTVFSEMRQECKCHGMSGSCTVRTCWMRLPTLR
AVGDVLRDRFDGASRVLYGNRGSNRASRAELLRLEPEDPAHKPPSPHDLVYFEKSPNFCT
YSGRLGTAGTAGRACNSSSPALDGCELLCCGRGHRTRTQRVTERCNCTFHWCCHVSCRNC
THTRVLHECL
NT seq 1113 nt   +upstreamnt  +downstreamnt
atggggcactgggcgctgctgcctggctgggtttctgctacgctgttgctggcgctggcc
gctctgcctgcagccctggccgccaacagcagtggccgatggtggggcatcgtgaacgta
gcctcctcaacgaacctactaaccgattccaagagtctgcaactggtactcgagcccagc
ctgcagctgctgagccgcaaacagcggcggctgatccgccagaacccggggatcctgcac
agtgtgagcggtgggctgcagagcgctgtgcgagagtgcaagtggcagttccggaaccgc
cgctggaattgtcccacggcttcagggccccacctcttcggcaagatcgtcaaccgaggc
tgtcgggaaacagcatttatcttcgccatcacctcggccggggtcacccattcggtggcg
cgctcctgctccgagggctccatcgagtcctgcacatgcgactataggcggcgcggccct
gggggccccgactggcactgggggggctgcagtgacaacatcgacttcggccgcctcttt
ggccgggagtttgtggattccggggagaaggggcgggacctgcgcttcctcatgaacctt
cacaacaacgaggcaggccgcacgaccgtgttctccgagatgcgccaggagtgcaagtgc
cacggtatgtccggttcgtgcactgtgcgcacgtgctggatgcggctgcccacgctgcgc
gccgtcggcgacgtgctgcgcgaccgcttcgacggtgcctcgcgcgtcctctacggcaac
cgcggcagcaaccgcgcctcgcgagcggaactgctgcgccttgagcccgaggacccagcg
cacaagcctccctccccccacgaccttgtctacttcgagaaatcgcccaacttctgcaca
tacagcgggcgcctgggtacagcgggcacggcggggcgcgcctgcaacagctcgtcgccc
gcgctggacggctgcgagctgctctgctgtggccggggccaccgcacgcgcacgcagcgc
gtcaccgagcgctgcaactgcaccttccactggtgctgccacgtcagctgccgcaactgc
acgcacacgcgcgtactgcacgagtgcctgtga

KEGG   Sus scrofa (pig): 100622044
Entry
100622044         CDS       T01009                                 

Gene name
WNT6
Definition
(RefSeq) protein Wnt-6
  KO
K00445  wingless-type MMTV integration site family, member 6
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04150  mTOR signaling pathway
ssc04310  Wnt signaling pathway
ssc04390  Hippo signaling pathway
ssc04550  Signaling pathways regulating pluripotency of stem cells
ssc04916  Melanogenesis
ssc04934  Cushing syndrome
ssc05010  Alzheimer disease
ssc05022  Pathways of neurodegeneration - multiple diseases
ssc05165  Human papillomavirus infection
ssc05200  Pathways in cancer
ssc05205  Proteoglycans in cancer
ssc05217  Basal cell carcinoma
ssc05224  Breast cancer
ssc05225  Hepatocellular carcinoma
ssc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100622044 (WNT6)
   04390 Hippo signaling pathway
    100622044 (WNT6)
   04150 mTOR signaling pathway
    100622044 (WNT6)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100622044 (WNT6)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100622044 (WNT6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100622044 (WNT6)
   05205 Proteoglycans in cancer
    100622044 (WNT6)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100622044 (WNT6)
   05226 Gastric cancer
    100622044 (WNT6)
   05217 Basal cell carcinoma
    100622044 (WNT6)
   05224 Breast cancer
    100622044 (WNT6)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100622044 (WNT6)
   05022 Pathways of neurodegeneration - multiple diseases
    100622044 (WNT6)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100622044 (WNT6)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100622044 (WNT6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:ssc00536]
    100622044 (WNT6)
Glycosaminoglycan binding proteins [BR:ssc00536]
 Heparan sulfate / Heparin
  Morphogens
   100622044 (WNT6)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 100622044
NCBI-ProteinID: XP_020931175
LinkDB
Position
15
AA seq 364 aa
MLPPAHSSLGLLLLLLCPAHVGGLWWAVGSPLVMDPTSICRKARRLAGRQAELCQAEPEV
VAELARGARLGVRECQFQFRFRRWNCSSHSKAFGRILQQDIRETAFVFAITAAGASHAVT
QACSMGELLQCGCQAPRGRAPPRPPGLPGTPGPPGSTSSPDGSAAWEWGGCGDDVDFGDE
KSRLFMDAQHKRGRGDIRALVQLHNNEAGRLAVRSHTRTECKCHGLSGSCALRTCWQKLP
PFREVGARLLERFHGASRVMGTNDGKALLPAVRTLKPPGRADLLYAADSPDFCAPNRRTG
SPGTRGRACNSSAPDLSGCDLLCCGRGHRQESVQLEENCLCRFHWCCVVQCHRCRVRKEL
SLCL
NT seq 1095 nt   +upstreamnt  +downstreamnt
atgctgccgcccgcgcactccagcctggggctgctgctgctgctcctatgtccggcgcac
gtcggcggactgtggtgggcggtgggcagccccttggtcatggaccctaccagcatctgc
aggaaggcacggcggctggcagggcggcaggctgagttgtgccaggcagagccagaggtg
gtggctgagctagcccggggcgctcggctgggggttcgagaatgccagtttcaattccgt
ttccgccgctggaactgctccagccacagcaaggcctttgggcgcatcctgcagcaggac
atccgggagacagccttcgtgtttgctataaccgctgcgggcgccagccacgcggtcacg
caggcctgctccatgggtgaactgctgcagtgcggctgccaggcgccccgtggccgggcc
ccgccccgccccccgggcctgccaggcacccctgggcccccaggctccacgagctcgccc
gatggcagcgccgcctgggagtggggaggctgtggcgacgatgtggacttcggggatgag
aagtcgaggctctttatggacgcgcagcacaagcggggacgtggtgacatccgtgcgttg
gtgcaacttcacaacaacgaggcaggcaggctggctgtgcggagccacacgaggaccgaa
tgcaagtgccacgggttgtcgggctcctgcgcgctgcgcacctgctggcagaagctaccc
ccgttccgcgaggtgggcgcgcggctgctcgagcgcttccacggcgcctcgcgtgtcatg
ggcaccaacgacggcaaagctctcctgcccgccgtccgcacgctcaagccgccgggccgc
gctgacctcctctacgcagccgactcgcccgacttctgtgcccccaaccggcgcaccggt
tcaccgggcacgcgcggccgcgcctgcaacagcagtgcccccgaccttagcggctgcgac
ctgctgtgttgcggccgtgggcaccgccaggagagcgtgcagctcgaggagaactgcctg
tgccgcttccactggtgctgtgtggtgcagtgccaccgctgccgcgtgcgcaaggaactc
agcctctgcctctga

KEGG   Sus scrofa (pig): 100623646
Entry
100623646         CDS       T01009                                 

Gene name
WNT10A
Definition
(RefSeq) LOW QUALITY PROTEIN: protein Wnt-10a
  KO
K01357  wingless-type MMTV integration site family, member 10
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04150  mTOR signaling pathway
ssc04310  Wnt signaling pathway
ssc04390  Hippo signaling pathway
ssc04550  Signaling pathways regulating pluripotency of stem cells
ssc04916  Melanogenesis
ssc04934  Cushing syndrome
ssc05010  Alzheimer disease
ssc05022  Pathways of neurodegeneration - multiple diseases
ssc05165  Human papillomavirus infection
ssc05200  Pathways in cancer
ssc05205  Proteoglycans in cancer
ssc05217  Basal cell carcinoma
ssc05224  Breast cancer
ssc05225  Hepatocellular carcinoma
ssc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100623646 (WNT10A)
   04390 Hippo signaling pathway
    100623646 (WNT10A)
   04150 mTOR signaling pathway
    100623646 (WNT10A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100623646 (WNT10A)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100623646 (WNT10A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100623646 (WNT10A)
   05205 Proteoglycans in cancer
    100623646 (WNT10A)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100623646 (WNT10A)
   05226 Gastric cancer
    100623646 (WNT10A)
   05217 Basal cell carcinoma
    100623646 (WNT10A)
   05224 Breast cancer
    100623646 (WNT10A)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100623646 (WNT10A)
   05022 Pathways of neurodegeneration - multiple diseases
    100623646 (WNT10A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100623646 (WNT10A)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100623646 (WNT10A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:ssc00536]
    100623646 (WNT10A)
Glycosaminoglycan binding proteins [BR:ssc00536]
 Heparan sulfate / Heparin
  Morphogens
   100623646 (WNT10A)
SSDB
Motif
Pfam: wnt Ebola_NP
Other DBs
NCBI-GeneID: 100623646
NCBI-ProteinID: XP_020931269
LinkDB
Position
15
AA seq 417 aa
MGSTHPCPWLRLRPRPQPRPALCALLFFLLLLAAAVPRSAPNDILGLRLPQEPVLNANTV
CLTLPGLSKRQMEVCVRHPDVAASAIQGIQIAIHECQHQFRDQRWNCSSLETRNKIPYES
PIFSRGFRESAFAYAISAAGVVHAVSNACALGKLRXCGCDASRRGDEEAFRRKLHHLQLE
ALQRGKGLSHGVPEHPALPPASPGLQDSWEWGGCSPDVGFGERFSKDFLDSREPHRDIHA
RMRLHNNRVGRQAVMENMRRKCKCHGTSGSCQLKTCWQVTPEFRAVGALLRSRFHRATLI
RPHNRNGGQLEPGPAGAPSPXPGVPGPRRRASPADLVYFEKSPDFCEREPRLDSAGTVGR
LCNKSSAGPDGCGSMCCGRGHNILRQTRSERCHCRFHWCCFVVCEECRITEWVSVCK
NT seq 1254 nt   +upstreamnt  +downstreamnt
atgggcagcacccacccttgcccttggctgcggctccgacctcggccccagccgcggccc
gcgctctgcgcgctcctcttcttcctactgctgctggctgccgccgtgcccaggtctgca
cccaacgatattttgggcctccgactcccccaggagcctgtcctcaacgccaacactgtg
tgcctgacgttgcctggcctgagcaagcggcagatggaggtgtgtgtgcgccacccagac
gtggctgcctcggccatccagggcatccagatcgccatccacgagtgccaacaccagttc
cgggaccagcgctggaactgctctagtctcgagactcgaaacaagatcccttatgagagt
cccatcttcagcagaggtttccgagagagtgccttcgcctacgccatctccgcagcgggc
gtggtgcacgcggtgtccaatgcctgtgccctgggcaaactgaggngctgtggctgcgat
gcatcccggcgaggggatgaggaggccttccggcggaagttgcatcacctgcagctggaa
gccctgcagcggggtaagggcctgagccacggagttcccgagcacccagccctgccccct
gccagccccggcctgcaggactcctgggagtggggcggctgcagcccggacgtgggtttc
ggagagcgcttctctaaagactttctggactcccgggagccacatagagacatccatgcg
cgcatgaggctccacaacaaccgagtggggaggcaggcggtgatggagaacatgcggcgg
aagtgcaagtgccacggcacgtcaggcagctgccagctcaagacgtgctggcaggtgacg
cctgagttccgcgcggtgggggcgctgctgcgcagccgcttccaccgcgccacgctcatc
cggccgcacaaccgcaacggcggccagctggagccgggccccgcgggggcaccctcgccg
nnccccggcgttccagggccacggcgccgcgccagccccgccgacctggtctacttcgag
aagtcccccgacttctgcgagcgggagccgcgtctggactcggcgggcactgtgggccgc
ctgtgcaacaagagcagcgcgggccccgacggctgtggcagcatgtgctgtggccgtggc
cacaacatcctacgccagacgcgcagtgagcgctgtcactgccgcttccactggtgctgc
ttcgtggtctgcgaggagtgccgcatcaccgagtgggtcagcgtctgcaagtga

KEGG   Sus scrofa (pig): 100626947
Entry
100626947         CDS       T01009                                 

Gene name
WNT7B
Definition
(RefSeq) protein Wnt-7b isoform X1
  KO
K00572  wingless-type MMTV integration site family, member 7
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04150  mTOR signaling pathway
ssc04310  Wnt signaling pathway
ssc04390  Hippo signaling pathway
ssc04550  Signaling pathways regulating pluripotency of stem cells
ssc04916  Melanogenesis
ssc04934  Cushing syndrome
ssc05010  Alzheimer disease
ssc05022  Pathways of neurodegeneration - multiple diseases
ssc05165  Human papillomavirus infection
ssc05200  Pathways in cancer
ssc05205  Proteoglycans in cancer
ssc05217  Basal cell carcinoma
ssc05224  Breast cancer
ssc05225  Hepatocellular carcinoma
ssc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100626947 (WNT7B)
   04390 Hippo signaling pathway
    100626947 (WNT7B)
   04150 mTOR signaling pathway
    100626947 (WNT7B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100626947 (WNT7B)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100626947 (WNT7B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100626947 (WNT7B)
   05205 Proteoglycans in cancer
    100626947 (WNT7B)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100626947 (WNT7B)
   05226 Gastric cancer
    100626947 (WNT7B)
   05217 Basal cell carcinoma
    100626947 (WNT7B)
   05224 Breast cancer
    100626947 (WNT7B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100626947 (WNT7B)
   05022 Pathways of neurodegeneration - multiple diseases
    100626947 (WNT7B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100626947 (WNT7B)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100626947 (WNT7B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:ssc00536]
    100626947 (WNT7B)
Glycosaminoglycan binding proteins [BR:ssc00536]
 Heparan sulfate / Heparin
  Morphogens
   100626947 (WNT7B)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 100626947
NCBI-ProteinID: XP_020947043
LinkDB
Position
5
AA seq 349 aa
MHRNFRKWIFYVFLCFGVLYVKLGALSSVVALGANIICNKIPGLAPRQRAICQSRPDAII
VIGEGAQMGINECQYQFRFGRWNCSALGEKTVFGQELRVGSREAAFTYAITAAGVAHAVT
AACSQGNLSNCGCDREKQGYYNQAEGWKWGGCSADVRYGIDFSRRFVDAREIKKNARRLM
NLHNNEAGRKVLEERMKLECKCHGVSGSCTTKTCWTTLPKFREVGHLLKEKYNVAVQVEV
VRASRLRQPTFLRIKQLRSYQKPMETDLVYIEKSPNYCEEDAATGSVGTQGRLCNRTSPG
ADGCDTMCCGRGYNTHQYTKVWQCNCKFHWCCFVKCNTCSERTEVFTCK
NT seq 1050 nt   +upstreamnt  +downstreamnt
atgcacagaaactttcgcaagtggattttctacgtgtttctctgctttggcgttctctac
gtgaagcttggagcgctgtcatccgtcgtggccctgggagccaacatcatttgcaacaag
atccctggcttggccccgcggcagcgcgccatctgccagagccggcccgatgccatcatc
gtgatcggggagggggcacagatgggcatcaacgagtgccagtaccagttccgcttcgga
cgctggaactgctccgccctcggcgagaagacggtcttcgggcaagagctccgagtaggg
agccgtgaggccgccttcacgtatgccatcaccgccgccggcgtggcccacgctgtcacc
gccgcctgcagccagggcaacctgagcaactgcgggtgcgaccgcgagaagcagggttac
tacaaccaggccgagggctggaagtggggcggctgctccgccgacgtgcgctacggcatc
gacttctcccggcgcttcgtggacgcccgcgagatcaagaaaaacgcccggcgcctcatg
aacctgcacaacaacgaggcgggcaggaaggtcctggaggagcgcatgaagctggagtgc
aagtgccacggcgtgtcgggctcgtgcaccaccaagacgtgctggaccacgctgcccaag
ttccgcgaggtgggccacttgctcaaggagaagtacaacgtggcggtgcaggtggaggta
gtgcgcgccagccgcctgcggcagcccaccttcctgcgcatcaagcagctgcgcagctac
cagaagcccatggagacggacctggtgtacatcgagaagtcgcccaactactgcgaggag
gacgcggccacgggcagcgtgggcacgcagggccgcctgtgcaaccgcacctcgcccggg
gctgacggctgcgacaccatgtgctgcggccgcgggtacaacacccaccagtacaccaag
gtctggcagtgcaactgcaagttccactggtgctgcttcgtcaagtgcaacacgtgcagc
gagcgcactgaggtcttcacctgcaagtga

KEGG   Sus scrofa (pig): 100627056
Entry
100627056         CDS       T01009                                 

Gene name
WNT5A
Definition
(RefSeq) protein Wnt-5a isoform X1
  KO
K00444  wingless-type MMTV integration site family, member 5
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04150  mTOR signaling pathway
ssc04310  Wnt signaling pathway
ssc04360  Axon guidance
ssc04390  Hippo signaling pathway
ssc04550  Signaling pathways regulating pluripotency of stem cells
ssc04916  Melanogenesis
ssc04934  Cushing syndrome
ssc05010  Alzheimer disease
ssc05022  Pathways of neurodegeneration - multiple diseases
ssc05165  Human papillomavirus infection
ssc05200  Pathways in cancer
ssc05205  Proteoglycans in cancer
ssc05217  Basal cell carcinoma
ssc05224  Breast cancer
ssc05225  Hepatocellular carcinoma
ssc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100627056 (WNT5A)
   04390 Hippo signaling pathway
    100627056 (WNT5A)
   04150 mTOR signaling pathway
    100627056 (WNT5A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100627056 (WNT5A)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100627056 (WNT5A)
  09158 Development and regeneration
   04360 Axon guidance
    100627056 (WNT5A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100627056 (WNT5A)
   05205 Proteoglycans in cancer
    100627056 (WNT5A)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100627056 (WNT5A)
   05226 Gastric cancer
    100627056 (WNT5A)
   05217 Basal cell carcinoma
    100627056 (WNT5A)
   05224 Breast cancer
    100627056 (WNT5A)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100627056 (WNT5A)
   05022 Pathways of neurodegeneration - multiple diseases
    100627056 (WNT5A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100627056 (WNT5A)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100627056 (WNT5A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:ssc00536]
    100627056 (WNT5A)
Glycosaminoglycan binding proteins [BR:ssc00536]
 Heparan sulfate / Heparin
  Morphogens
   100627056 (WNT5A)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 100627056
NCBI-ProteinID: XP_005669715
Ensembl: ENSSSCG00000029852
LinkDB
Position
13
AA seq 419 aa
MVPRWRSGRQLQTRIKGNWSPPWLPFPSLRGSYREWGPPEEKSIGILSPGVALGTAGRAM
SSKFFLMALAIFISFAQVVIEANSWWSLGMNNPVQMSEVYIIGAQPLCSQLAGLSQGQKK
LCHLYQDHMQYIGEGAKTGIKECQYQFRHRRWNCSTVDNTSVFGRVMQIGSRETAFTYAV
SAAGVVNAMSRACREGELSTCGCSRAARPKDLPRDWLWGGCGDNIDYGYRFAKEFVDARE
RERIHAKGSYESARILMNLHNNEAGRRTVYNLADVACKCHGVSGSCSLKTCWLQLADFRK
VGDALKEKYDSAAAMRLNSRGKLVQVNSRFNSPTTQDLVYIDPSPDYCVRNESTGSLGTQ
GRLCNKTSEGMDGCELMCCGRGYDQFKTVQTERCHCKFHWCCYVKCKKCTEIVDQFVCK
NT seq 1260 nt   +upstreamnt  +downstreamnt
atggtgccacgatggcgaagtggtcgacaactccagaccaggatcaaaggaaactggagt
cccccttggcttcctttcccctctctccgtggcagctaccgggagtggggaccaccggag
gagaagtcgattggaatattaagcccaggagttgctttggggacggctggaagggcaatg
tcttccaagttcttcctaatggctttggccatatttatctccttcgcccaggttgtaata
gaagccaattcttggtggtccttaggtatgaataaccctgttcagatgtcagaagtatat
atcataggagcacagcctctctgcagccaactggcaggactttctcaaggacagaagaaa
ctatgccacttgtatcaggaccacatgcagtacatcggagagggcgcgaagacaggcatc
aaagaatgccagtatcagttccgccaccggaggtggaactgcagcacggtggataacacc
tccgtcttcggcagggtcatgcagataggcagccgcgagacggctttcacgtacgctgtg
agcgccgcgggggtggtcaatgccatgagccgcgcgtgccgagagggcgagctgtccacc
tgcggctgcagccgtgccgcgcgccccaaggacctgccccgggactggctgtggggcggc
tgcggagacaacatcgactacggctaccgcttcgccaaggagttcgtggacgcccgcgag
cgggagcgcatccatgccaagggctcctacgagagcgcgcgcatcctcatgaacctgcac
aacaacgaggccggccgccggacggtgtacaacctggccgacgtggcctgcaagtgccac
ggcgtgtctggctcatgcagcctcaagacatgctggctgcagctggccgacttccgtaag
gtgggtgacgccctgaaggagaagtatgacagcgcggcggccatgcggctcaacagccgg
ggcaagctggtgcaggtcaacagccgcttcaactcgcccaccacacaggacctggtctac
atcgaccccagccccgactactgtgtgcgcaatgagagcaccggctcgctgggcacgcag
ggccgcctgtgcaacaagacgtctgagggcatggacggctgtgagctcatgtgctgtggc
cgcggctacgatcagttcaagaccgtgcagactgagcgctgccactgcaagttccactgg
tgctgctacgtcaagtgcaagaagtgcacggagatcgtggaccagttcgtgtgcaagtag

KEGG   Sus scrofa (pig): 100738655
Entry
100738655         CDS       T01009                                 

Gene name
WNT9B
Definition
(RefSeq) protein Wnt-9b
  KO
K01064  wingless-type MMTV integration site family, member 9
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04150  mTOR signaling pathway
ssc04310  Wnt signaling pathway
ssc04390  Hippo signaling pathway
ssc04550  Signaling pathways regulating pluripotency of stem cells
ssc04916  Melanogenesis
ssc04934  Cushing syndrome
ssc05010  Alzheimer disease
ssc05022  Pathways of neurodegeneration - multiple diseases
ssc05165  Human papillomavirus infection
ssc05200  Pathways in cancer
ssc05205  Proteoglycans in cancer
ssc05217  Basal cell carcinoma
ssc05224  Breast cancer
ssc05225  Hepatocellular carcinoma
ssc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100738655 (WNT9B)
   04390 Hippo signaling pathway
    100738655 (WNT9B)
   04150 mTOR signaling pathway
    100738655 (WNT9B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100738655 (WNT9B)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100738655 (WNT9B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100738655 (WNT9B)
   05205 Proteoglycans in cancer
    100738655 (WNT9B)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100738655 (WNT9B)
   05226 Gastric cancer
    100738655 (WNT9B)
   05217 Basal cell carcinoma
    100738655 (WNT9B)
   05224 Breast cancer
    100738655 (WNT9B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100738655 (WNT9B)
   05022 Pathways of neurodegeneration - multiple diseases
    100738655 (WNT9B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100738655 (WNT9B)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100738655 (WNT9B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:ssc00536]
    100738655 (WNT9B)
Glycosaminoglycan binding proteins [BR:ssc00536]
 Heparan sulfate / Heparin
  Morphogens
   100738655 (WNT9B)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 100738655
NCBI-ProteinID: XP_020922486
LinkDB
Position
12
AA seq 357 aa
MRPPPALALAALCLLALPAAAAAAYFGLTGREVLTPFPGLGTAAPAQGGAHLKQCDLLKL
SRRQKQLCRREPGLAETLQDAAHLSLLECQFQFRHERWNCSLEGRTGLLKRGFKETAFLY
AVSSAALTHTLARACSAGRMERCTCDDSPGLESRQAWQWGVCGDNLKYSTKFLNNFLGPK
RGSKDLRARADAHNTHVGIKAVKSGLRTTCKCHGVSGSCAVRTCWRQLSPFRETGQVLKL
RYDSAVKVSSATNEALGRLELWAPARPGSPTKGPAPRPGDLVYMEDSPSFCRPSKYSPGT
AGRVCSREASCSSLCCGRGYDTQSRLVAFSCHCQVQWCCYVECQQCVQEELVYTCKH
NT seq 1074 nt   +upstreamnt  +downstreamnt
atgcgccccccgcccgcgctggccctggccgcgctctgcctgctggcgctgcccgccgcc
gccgccgccgcctacttcggcctgaccgggcgggaggtcctgacgcccttcccagggctg
ggcactgctgccccagcacagggcggggcccacctgaagcaatgtgacctcctgaagctg
tcccgccggcagaagcagctctgccgacgggagccaggcctggctgagaccctgcaggac
gccgcacacctcagcctgctcgagtgccagtttcagttccggcatgagcgctggaactgc
agcctggaggggaggacggggctgctcaagagaggtttcaaggagacggccttcctgtat
gcggtgtcctcggctgccctcacgcacacgctggcccgggcctgcagcgccggccgcatg
gagcgctgcacctgcgatgactctccgggcttggagagccggcaggcctggcagtggggc
gtgtgcggcgacaacctcaagtacagcaccaagttcctgaacaacttcctggggcccaag
agaggaagcaaagacctgcgggctcgggcagatgcccacaacacccacgtgggcattaag
gccgtgaagagtggcctcaggaccacgtgtaagtgccacggcgtgtcgggctcctgtgct
gtgcgtacctgctggaggcagctgtccccgttccgcgagaccggccaggtgttgaagctg
cgctacgattcggccgtcaaggtgtccagtgccaccaacgaggctttgggccgcctggag
ctgtgggcacctgccaggccgggtagccccaccaagggcccggccccgcgacctggagac
ctggtctacatggaggactcacccagtttctgccggcccagcaagtattcgcctggcaca
gcgggcagggtgtgctcccgggaggccagctgcagcagcctgtgctgcgggcggggctat
gacacccagagccgcctggtggccttctcctgccactgccaggtgcagtggtgctgctac
gtggagtgccagcagtgtgtgcaggaggagctcgtgtacacctgtaagcactag

KEGG   Sus scrofa (pig): 100739710
Entry
100739710         CDS       T01009                                 

Gene name
WNT8A
Definition
(RefSeq) protein Wnt-8a
  KO
K00714  wingless-type MMTV integration site family, member 8
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04150  mTOR signaling pathway
ssc04310  Wnt signaling pathway
ssc04390  Hippo signaling pathway
ssc04550  Signaling pathways regulating pluripotency of stem cells
ssc04916  Melanogenesis
ssc04934  Cushing syndrome
ssc05010  Alzheimer disease
ssc05022  Pathways of neurodegeneration - multiple diseases
ssc05165  Human papillomavirus infection
ssc05200  Pathways in cancer
ssc05205  Proteoglycans in cancer
ssc05217  Basal cell carcinoma
ssc05224  Breast cancer
ssc05225  Hepatocellular carcinoma
ssc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100739710 (WNT8A)
   04390 Hippo signaling pathway
    100739710 (WNT8A)
   04150 mTOR signaling pathway
    100739710 (WNT8A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100739710 (WNT8A)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100739710 (WNT8A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100739710 (WNT8A)
   05205 Proteoglycans in cancer
    100739710 (WNT8A)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100739710 (WNT8A)
   05226 Gastric cancer
    100739710 (WNT8A)
   05217 Basal cell carcinoma
    100739710 (WNT8A)
   05224 Breast cancer
    100739710 (WNT8A)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100739710 (WNT8A)
   05022 Pathways of neurodegeneration - multiple diseases
    100739710 (WNT8A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100739710 (WNT8A)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100739710 (WNT8A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:ssc00536]
    100739710 (WNT8A)
Glycosaminoglycan binding proteins [BR:ssc00536]
 Heparan sulfate / Heparin
  Morphogens
   100739710 (WNT8A)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 100739710
NCBI-ProteinID: XP_003480966
LinkDB
Position
2
AA seq 352 aa
MGDLLMLRVAVGICYATFSASAWSVNNFLITGPKAYLTYTASVALGAQSGIEECKFQFAW
ERWNCPENALQLSTHNRLRSATRETSFIHAISSAGVMYTITKNCSMGDFENCGCDESKNG
KTGGHGWIWGGCSDNVEFGERISKLFVDSLEKGKDARALMNLHNNRAGRLAVRATMKRTC
KCHGISGSCSIQTCWLQLANFREMGNYLKAKYDQALKIEMDKRRLRAGNSAEGHWVPAEA
FLPSAEAELIFLEESPDYCIHNSSLGVYGTEGRECLQNSHNTSRWEQRSCGRLCTECGLQ
VEKRRTETISSCNCKFQWCCTVKCDQCRHVVNKYYCTRTPGNAWSQGQGSMP
NT seq 1059 nt   +upstreamnt  +downstreamnt
atgggggacctgcttatgctcagggtagctgtgggcatatgctatgccactttcagtgcc
tctgcctggtcagtgaataatttcctgataacaggtcccaaggcctatctgacctacact
gccagtgtggccctaggtgcccagagtggcatcgaggagtgtaaattccagtttgcttgg
gaacgctggaactgtcctgaaaatgctctccagctctccacccacaacaggctgagaagt
gccaccagggagacttctttcattcatgctatcagctctgctggagtcatgtacaccatc
accaagaactgtagcatgggcgactttgaaaactgtggctgtgatgagtcaaaaaatgga
aaaacaggaggccatggctggatctggggaggctgcagtgacaatgtagaatttggggaa
agaatctccaaactctttgtggacagcctggagaaggggaaggatgccagagctctgatg
aatcttcacaacaacagggcaggcaggctggcagtgagagccaccatgaaaaggacctgc
aaatgtcatggcatctctgggagctgtagcatccagacatgctggctgcagctagctaac
ttccgggagatgggcaactaccttaaggccaagtatgaccaggcactaaaaattgagatg
gataagcggcggctaagggctgggaacagtgccgagggccactgggtacctgctgaggcc
ttccttcctagtgcagaagccgagttgatctttttagaggaatcacctgattactgtatc
cacaattccagcctgggtgtctatggcacagagggtcgggagtgtctgcagaacagccac
aacacatccaggtgggagcaacgtagctgcgggcgcttgtgcaccgaatgtggcctgcag
gtggaaaaaaggagaactgagactatcagcagctgtaactgcaaattccagtggtgctgt
acagtcaagtgtgaccagtgtaggcatgtggtgaacaagtactattgcacacgcacccca
ggcaatgcttggtctcagggccaaggcagcatgccatag

DBGET integrated database retrieval system