KEGG   Sus scrofa (pig): 100126852
Entry
100126852         CDS       T01009                                 

Gene name
GSK3B
Definition
(RefSeq) glycogen synthase kinase-3 beta
  KO
K03083  glycogen synthase kinase 3 beta [EC:2.7.11.26]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc01521  EGFR tyrosine kinase inhibitor resistance
ssc04012  ErbB signaling pathway
ssc04062  Chemokine signaling pathway
ssc04110  Cell cycle
ssc04150  mTOR signaling pathway
ssc04151  PI3K-Akt signaling pathway
ssc04310  Wnt signaling pathway
ssc04340  Hedgehog signaling pathway
ssc04360  Axon guidance
ssc04390  Hippo signaling pathway
ssc04510  Focal adhesion
ssc04550  Signaling pathways regulating pluripotency of stem cells
ssc04657  IL-17 signaling pathway
ssc04660  T cell receptor signaling pathway
ssc04662  B cell receptor signaling pathway
ssc04722  Neurotrophin signaling pathway
ssc04728  Dopaminergic synapse
ssc04910  Insulin signaling pathway
ssc04916  Melanogenesis
ssc04917  Prolactin signaling pathway
ssc04919  Thyroid hormone signaling pathway
ssc04931  Insulin resistance
ssc04932  Non-alcoholic fatty liver disease
ssc04934  Cushing syndrome
ssc04935  Growth hormone synthesis, secretion and action
ssc05010  Alzheimer disease
ssc05020  Prion disease
ssc05022  Pathways of neurodegeneration - multiple diseases
ssc05135  Yersinia infection
ssc05160  Hepatitis C
ssc05162  Measles
ssc05163  Human cytomegalovirus infection
ssc05165  Human papillomavirus infection
ssc05167  Kaposi sarcoma-associated herpesvirus infection
ssc05200  Pathways in cancer
ssc05210  Colorectal cancer
ssc05213  Endometrial cancer
ssc05215  Prostate cancer
ssc05217  Basal cell carcinoma
ssc05224  Breast cancer
ssc05225  Hepatocellular carcinoma
ssc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100126852 (GSK3B)
   04310 Wnt signaling pathway
    100126852 (GSK3B)
   04340 Hedgehog signaling pathway
    100126852 (GSK3B)
   04390 Hippo signaling pathway
    100126852 (GSK3B)
   04151 PI3K-Akt signaling pathway
    100126852 (GSK3B)
   04150 mTOR signaling pathway
    100126852 (GSK3B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100126852 (GSK3B)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100126852 (GSK3B)
   04550 Signaling pathways regulating pluripotency of stem cells
    100126852 (GSK3B)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    100126852 (GSK3B)
   04657 IL-17 signaling pathway
    100126852 (GSK3B)
   04662 B cell receptor signaling pathway
    100126852 (GSK3B)
   04062 Chemokine signaling pathway
    100126852 (GSK3B)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100126852 (GSK3B)
   04917 Prolactin signaling pathway
    100126852 (GSK3B)
   04935 Growth hormone synthesis, secretion and action
    100126852 (GSK3B)
   04919 Thyroid hormone signaling pathway
    100126852 (GSK3B)
   04916 Melanogenesis
    100126852 (GSK3B)
  09156 Nervous system
   04728 Dopaminergic synapse
    100126852 (GSK3B)
   04722 Neurotrophin signaling pathway
    100126852 (GSK3B)
  09158 Development and regeneration
   04360 Axon guidance
    100126852 (GSK3B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100126852 (GSK3B)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100126852 (GSK3B)
   05225 Hepatocellular carcinoma
    100126852 (GSK3B)
   05226 Gastric cancer
    100126852 (GSK3B)
   05217 Basal cell carcinoma
    100126852 (GSK3B)
   05215 Prostate cancer
    100126852 (GSK3B)
   05213 Endometrial cancer
    100126852 (GSK3B)
   05224 Breast cancer
    100126852 (GSK3B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100126852 (GSK3B)
   05020 Prion disease
    100126852 (GSK3B)
   05022 Pathways of neurodegeneration - multiple diseases
    100126852 (GSK3B)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100126852 (GSK3B)
   04931 Insulin resistance
    100126852 (GSK3B)
   04934 Cushing syndrome
    100126852 (GSK3B)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100126852 (GSK3B)
  09172 Infectious disease: viral
   05160 Hepatitis C
    100126852 (GSK3B)
   05162 Measles
    100126852 (GSK3B)
   05163 Human cytomegalovirus infection
    100126852 (GSK3B)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100126852 (GSK3B)
   05165 Human papillomavirus infection
    100126852 (GSK3B)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100126852 (GSK3B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ssc01001]
    100126852 (GSK3B)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ssc03036]
    100126852 (GSK3B)
Enzymes [BR:ssc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.26  tau-protein kinase
     100126852 (GSK3B)
Protein kinases [BR:ssc01001]
 Serine/threonine kinases: CMGC group
  GSK family [OT]
   100126852 (GSK3B)
Chromosome and associated proteins [BR:ssc03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    100126852 (GSK3B)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like APH Kdo ABC1
Other DBs
NCBI-GeneID: 100126852
NCBI-ProteinID: NP_001121915
Ensembl: ENSSSCG00000011889
UniProt: B2LUN4
LinkDB
Position
13
AA seq 420 aa
MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTMVATPGQGPDRPQEVSYTDAK
VIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSG
EKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHR
DIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDV
WSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHP
WTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALF
NFTTQELSSNPPLATILIPPHARIQAAASTPSNATAASDTNAGDRGQTNNTASASASNST
NT seq 1263 nt   +upstreamnt  +downstreamnt
atgtcagggcggcccagaaccacctcctttgcggagagctgcaagccagtgcagcagcct
tcagcttttggcagcatgaaagttagcagagacaaggatggcagcaaggtgaccacaatg
gtggcaactcctgggcagggtccagacaggccacaagaagtcagctatacagacgctaaa
gtgattggaaatgggtcatttggtgtggtgtatcaagccaagctttgtgattcaggagaa
ctggttgccatcaagaaagtattgcaggacaagagatttaagaaccgagagctccaaatc
atgagaaagctagatcactgtaacatagtccgattgcgttatttcttctactcaagtggt
gaaaagaaagatgaggtctatcttaatctggtgctggactatgttccggaaacagtatac
agagttgccagacactatagtcgagccaaacagacgctccctgtgatctatgtcaagttg
tatatgtatcagctgttccgaagtttagcctatatccattcctttggaatctgccatcgg
gatattaaaccacagaacctcttgttggatcctgatacagctgtcttaaaactctgtgac
tttggaagtgcaaagcagctggtccgaggagaacccaatgtttcgtatatctgttctcgg
tactatagggcaccagagttgatctttggagccactgattatacctctagtatagatgtg
tggtctgcaggctgtgtgttggctgaactgttgctaggacaacctatatttccaggggat
agtggtgtggatcaattggtggaaataatcaaggtcctagggacaccaacaagggagcaa
attagagaaatgaacccaaactacacagaattcaaattccctcaaattaaggcacatcct
tggactaaggtcttccggccccgaactcccccagaggccattgcactatgtagccgtctg
ttggagtacacaccaactgcccgattgacaccactggaagcttgtgcgcattcatttttt
gatgaattacgggacccaaatgtcaaattaccaaatgggcgagacacacctgcactcttc
aacttcaccactcaagaattgtcaagtaatccacctctagctaccatccttattcctcct
catgctcggattcaagcagctgcttcaaccccttcaaatgccacagcagcctcagatact
aatgccggagatcgtgggcagaccaataacaccgcttctgcgtcagcttccaattccacc
tga

DBGET integrated database retrieval system