KEGG   Sus scrofa (pig): 100126861
Entry
100126861         CDS       T01009                                 

Gene name
AKT1
Definition
(RefSeq) RAC-alpha serine/threonine-protein kinase
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc01521  EGFR tyrosine kinase inhibitor resistance
ssc01522  Endocrine resistance
ssc01524  Platinum drug resistance
ssc04010  MAPK signaling pathway
ssc04012  ErbB signaling pathway
ssc04014  Ras signaling pathway
ssc04015  Rap1 signaling pathway
ssc04022  cGMP-PKG signaling pathway
ssc04024  cAMP signaling pathway
ssc04062  Chemokine signaling pathway
ssc04066  HIF-1 signaling pathway
ssc04068  FoxO signaling pathway
ssc04071  Sphingolipid signaling pathway
ssc04072  Phospholipase D signaling pathway
ssc04140  Autophagy - animal
ssc04150  mTOR signaling pathway
ssc04151  PI3K-Akt signaling pathway
ssc04152  AMPK signaling pathway
ssc04210  Apoptosis
ssc04211  Longevity regulating pathway
ssc04213  Longevity regulating pathway - multiple species
ssc04218  Cellular senescence
ssc04261  Adrenergic signaling in cardiomyocytes
ssc04370  VEGF signaling pathway
ssc04371  Apelin signaling pathway
ssc04380  Osteoclast differentiation
ssc04510  Focal adhesion
ssc04550  Signaling pathways regulating pluripotency of stem cells
ssc04611  Platelet activation
ssc04613  Neutrophil extracellular trap formation
ssc04620  Toll-like receptor signaling pathway
ssc04625  C-type lectin receptor signaling pathway
ssc04630  JAK-STAT signaling pathway
ssc04660  T cell receptor signaling pathway
ssc04662  B cell receptor signaling pathway
ssc04664  Fc epsilon RI signaling pathway
ssc04666  Fc gamma R-mediated phagocytosis
ssc04668  TNF signaling pathway
ssc04722  Neurotrophin signaling pathway
ssc04725  Cholinergic synapse
ssc04728  Dopaminergic synapse
ssc04910  Insulin signaling pathway
ssc04914  Progesterone-mediated oocyte maturation
ssc04915  Estrogen signaling pathway
ssc04917  Prolactin signaling pathway
ssc04919  Thyroid hormone signaling pathway
ssc04920  Adipocytokine signaling pathway
ssc04922  Glucagon signaling pathway
ssc04923  Regulation of lipolysis in adipocytes
ssc04926  Relaxin signaling pathway
ssc04929  GnRH secretion
ssc04931  Insulin resistance
ssc04932  Non-alcoholic fatty liver disease
ssc04933  AGE-RAGE signaling pathway in diabetic complications
ssc04935  Growth hormone synthesis, secretion and action
ssc04973  Carbohydrate digestion and absorption
ssc05010  Alzheimer disease
ssc05017  Spinocerebellar ataxia
ssc05132  Salmonella infection
ssc05135  Yersinia infection
ssc05142  Chagas disease
ssc05145  Toxoplasmosis
ssc05152  Tuberculosis
ssc05160  Hepatitis C
ssc05161  Hepatitis B
ssc05162  Measles
ssc05163  Human cytomegalovirus infection
ssc05164  Influenza A
ssc05165  Human papillomavirus infection
ssc05166  Human T-cell leukemia virus 1 infection
ssc05167  Kaposi sarcoma-associated herpesvirus infection
ssc05168  Herpes simplex virus 1 infection
ssc05169  Epstein-Barr virus infection
ssc05170  Human immunodeficiency virus 1 infection
ssc05200  Pathways in cancer
ssc05205  Proteoglycans in cancer
ssc05210  Colorectal cancer
ssc05211  Renal cell carcinoma
ssc05212  Pancreatic cancer
ssc05213  Endometrial cancer
ssc05214  Glioma
ssc05215  Prostate cancer
ssc05218  Melanoma
ssc05220  Chronic myeloid leukemia
ssc05221  Acute myeloid leukemia
ssc05222  Small cell lung cancer
ssc05223  Non-small cell lung cancer
ssc05224  Breast cancer
ssc05225  Hepatocellular carcinoma
ssc05226  Gastric cancer
ssc05230  Central carbon metabolism in cancer
ssc05231  Choline metabolism in cancer
ssc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ssc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100126861 (AKT1)
   04012 ErbB signaling pathway
    100126861 (AKT1)
   04014 Ras signaling pathway
    100126861 (AKT1)
   04015 Rap1 signaling pathway
    100126861 (AKT1)
   04370 VEGF signaling pathway
    100126861 (AKT1)
   04371 Apelin signaling pathway
    100126861 (AKT1)
   04630 JAK-STAT signaling pathway
    100126861 (AKT1)
   04668 TNF signaling pathway
    100126861 (AKT1)
   04066 HIF-1 signaling pathway
    100126861 (AKT1)
   04068 FoxO signaling pathway
    100126861 (AKT1)
   04072 Phospholipase D signaling pathway
    100126861 (AKT1)
   04071 Sphingolipid signaling pathway
    100126861 (AKT1)
   04024 cAMP signaling pathway
    100126861 (AKT1)
   04022 cGMP-PKG signaling pathway
    100126861 (AKT1)
   04151 PI3K-Akt signaling pathway
    100126861 (AKT1)
   04152 AMPK signaling pathway
    100126861 (AKT1)
   04150 mTOR signaling pathway
    100126861 (AKT1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100126861 (AKT1)
  09143 Cell growth and death
   04210 Apoptosis
    100126861 (AKT1)
   04218 Cellular senescence
    100126861 (AKT1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100126861 (AKT1)
   04550 Signaling pathways regulating pluripotency of stem cells
    100126861 (AKT1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100126861 (AKT1)
   04613 Neutrophil extracellular trap formation
    100126861 (AKT1)
   04620 Toll-like receptor signaling pathway
    100126861 (AKT1)
   04625 C-type lectin receptor signaling pathway
    100126861 (AKT1)
   04660 T cell receptor signaling pathway
    100126861 (AKT1)
   04662 B cell receptor signaling pathway
    100126861 (AKT1)
   04664 Fc epsilon RI signaling pathway
    100126861 (AKT1)
   04666 Fc gamma R-mediated phagocytosis
    100126861 (AKT1)
   04062 Chemokine signaling pathway
    100126861 (AKT1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100126861 (AKT1)
   04922 Glucagon signaling pathway
    100126861 (AKT1)
   04923 Regulation of lipolysis in adipocytes
    100126861 (AKT1)
   04920 Adipocytokine signaling pathway
    100126861 (AKT1)
   04929 GnRH secretion
    100126861 (AKT1)
   04915 Estrogen signaling pathway
    100126861 (AKT1)
   04914 Progesterone-mediated oocyte maturation
    100126861 (AKT1)
   04917 Prolactin signaling pathway
    100126861 (AKT1)
   04926 Relaxin signaling pathway
    100126861 (AKT1)
   04935 Growth hormone synthesis, secretion and action
    100126861 (AKT1)
   04919 Thyroid hormone signaling pathway
    100126861 (AKT1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100126861 (AKT1)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100126861 (AKT1)
  09156 Nervous system
   04725 Cholinergic synapse
    100126861 (AKT1)
   04728 Dopaminergic synapse
    100126861 (AKT1)
   04722 Neurotrophin signaling pathway
    100126861 (AKT1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100126861 (AKT1)
  09149 Aging
   04211 Longevity regulating pathway
    100126861 (AKT1)
   04213 Longevity regulating pathway - multiple species
    100126861 (AKT1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100126861 (AKT1)
   05205 Proteoglycans in cancer
    100126861 (AKT1)
   05230 Central carbon metabolism in cancer
    100126861 (AKT1)
   05231 Choline metabolism in cancer
    100126861 (AKT1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100126861 (AKT1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100126861 (AKT1)
   05212 Pancreatic cancer
    100126861 (AKT1)
   05225 Hepatocellular carcinoma
    100126861 (AKT1)
   05226 Gastric cancer
    100126861 (AKT1)
   05214 Glioma
    100126861 (AKT1)
   05221 Acute myeloid leukemia
    100126861 (AKT1)
   05220 Chronic myeloid leukemia
    100126861 (AKT1)
   05218 Melanoma
    100126861 (AKT1)
   05211 Renal cell carcinoma
    100126861 (AKT1)
   05215 Prostate cancer
    100126861 (AKT1)
   05213 Endometrial cancer
    100126861 (AKT1)
   05224 Breast cancer
    100126861 (AKT1)
   05222 Small cell lung cancer
    100126861 (AKT1)
   05223 Non-small cell lung cancer
    100126861 (AKT1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100126861 (AKT1)
   05017 Spinocerebellar ataxia
    100126861 (AKT1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100126861 (AKT1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100126861 (AKT1)
   04931 Insulin resistance
    100126861 (AKT1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100126861 (AKT1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100126861 (AKT1)
   05135 Yersinia infection
    100126861 (AKT1)
   05152 Tuberculosis
    100126861 (AKT1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100126861 (AKT1)
   05170 Human immunodeficiency virus 1 infection
    100126861 (AKT1)
   05161 Hepatitis B
    100126861 (AKT1)
   05160 Hepatitis C
    100126861 (AKT1)
   05164 Influenza A
    100126861 (AKT1)
   05162 Measles
    100126861 (AKT1)
   05168 Herpes simplex virus 1 infection
    100126861 (AKT1)
   05163 Human cytomegalovirus infection
    100126861 (AKT1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100126861 (AKT1)
   05169 Epstein-Barr virus infection
    100126861 (AKT1)
   05165 Human papillomavirus infection
    100126861 (AKT1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100126861 (AKT1)
   05142 Chagas disease
    100126861 (AKT1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100126861 (AKT1)
   01524 Platinum drug resistance
    100126861 (AKT1)
   01522 Endocrine resistance
    100126861 (AKT1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ssc01001]
    100126861 (AKT1)
Enzymes [BR:ssc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100126861 (AKT1)
Protein kinases [BR:ssc01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   100126861 (AKT1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Pkinase_C Kinase-like PH_11 Seadorna_VP7 Pkinase_fungal APH
Other DBs
NCBI-GeneID: 100126861
NCBI-ProteinID: NP_001153248
UniProt: C1PIG3
LinkDB
Position
6
AA seq 480 aa
MNDVAVVKEGWLHKRGEYIKTWRPRYFLLKNDGTFIGYKERPQDLEQRESPLNNFSVAQC
RLMKTERPRPNTFIIRCLQWTTVIERTFHVETPEEREEWTTAIQTVADGLKRQEEEMMDF
RSGSPSENSGAEEMEVSLAKPKHRVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKI
LKKEVIVAKDEVAHTLTENRVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLS
RERVFPEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEGI
KDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFEL
ILMEEIRFPRTLSPEAKSLLSGLLKKDPKQRLGGGSEDAKEIMQHRFFASIVWQDVYEKK
LSPPFKPQVTSETDTRYFDEEFTAQMITITPPDQDDSMEGVDSERRPHFPQFSYSASGTA
NT seq 1443 nt   +upstreamnt  +downstreamnt
atgaacgacgtggccgtcgtgaaggagggctggctgcacaaacgaggcgagtacatcaag
acgtggcggccgcggtacttcctcctcaagaacgacggcaccttcatcggctacaaggag
cggccgcaggacctggagcagcgcgagtcgcccctcaacaacttctccgtggcgcaatgc
cggctgatgaagacggagcggccgcggcccaacaccttcatcatccgctgcctgcagtgg
acgaccgtcatcgagcgaacgttccacgtggagacgccggaggagcgggaggagtggacg
accgccatccagacggtggccgacgggctcaagcggcaggaggaagagatgatggacttc
cggtcgggctcgcccagcgagaactccggggccgaggagatggaggtgtccctggctaag
cccaaacaccgcgtgaccatgaatgagttcgagtacctgaagctgctgggcaaaggcacc
ttcgggaaggtgatcctggtgaaggagaaggccacgggccgctactacgccatgaagatc
ctgaagaaggaggtcatcgtggccaaggacgaggtcgcccacacgctcacggagaaccgc
gtcctccagaactctcggcacccgttcctgacggccttgaagtactccttccagacccac
gaccgcctgtgcttcgtcatggagtacgccaacggcggcgagctcttcttccacctgtcc
cgggagcgggtgttccccgaggatcgggcccgcttctacggcgccgagatcgtgtcggcc
ttggactacctgcactccgagaagaacgtggtgtatcgggacctcaagctggagaacctc
atgctggacaaggacgggcacatcaagatcactgacttcgggctctgcaaggagggcatc
aaggacggcgccaccatgaagaccttctgtgggacgcccgagtacctggcccccgaggtg
ctggaggacaacgactacggccgggcggtggactggtggggactgggcgtggtcatgtac
gagatgatgtgcggccgcctgcccttctacaaccaggaccacgagaagctcttcgagctc
atcctcatggaggagatccgcttcccgcgcacgctcagccccgaggccaagtccctgctc
tcagggctgctcaagaaggaccccaagcagcggctcggcgggggctctgaggatgccaag
gagatcatgcagcaccgtttcttcgccagcatcgtgtggcaggatgtgtatgagaagaag
ctcagcccaccgttcaagcctcaggtcacgtccgagacggacaccaggtatttcgacgag
gagttcacggcgcagatgatcaccatcacgccgcccgaccaagacgacagcatggagggc
gtggacagcgagcggaggcctcacttcccccagttctcctactcggccagcggcacggcc
tga

KEGG   Sus scrofa (pig): 100127478
Entry
100127478         CDS       T01009                                 

Gene name
AKT2
Definition
(RefSeq) RAC-beta serine/threonine-protein kinase
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc01521  EGFR tyrosine kinase inhibitor resistance
ssc01522  Endocrine resistance
ssc01524  Platinum drug resistance
ssc04010  MAPK signaling pathway
ssc04012  ErbB signaling pathway
ssc04014  Ras signaling pathway
ssc04015  Rap1 signaling pathway
ssc04022  cGMP-PKG signaling pathway
ssc04024  cAMP signaling pathway
ssc04062  Chemokine signaling pathway
ssc04066  HIF-1 signaling pathway
ssc04068  FoxO signaling pathway
ssc04071  Sphingolipid signaling pathway
ssc04072  Phospholipase D signaling pathway
ssc04140  Autophagy - animal
ssc04150  mTOR signaling pathway
ssc04151  PI3K-Akt signaling pathway
ssc04152  AMPK signaling pathway
ssc04210  Apoptosis
ssc04211  Longevity regulating pathway
ssc04213  Longevity regulating pathway - multiple species
ssc04218  Cellular senescence
ssc04261  Adrenergic signaling in cardiomyocytes
ssc04370  VEGF signaling pathway
ssc04371  Apelin signaling pathway
ssc04380  Osteoclast differentiation
ssc04510  Focal adhesion
ssc04550  Signaling pathways regulating pluripotency of stem cells
ssc04611  Platelet activation
ssc04613  Neutrophil extracellular trap formation
ssc04620  Toll-like receptor signaling pathway
ssc04625  C-type lectin receptor signaling pathway
ssc04630  JAK-STAT signaling pathway
ssc04660  T cell receptor signaling pathway
ssc04662  B cell receptor signaling pathway
ssc04664  Fc epsilon RI signaling pathway
ssc04666  Fc gamma R-mediated phagocytosis
ssc04668  TNF signaling pathway
ssc04722  Neurotrophin signaling pathway
ssc04725  Cholinergic synapse
ssc04728  Dopaminergic synapse
ssc04910  Insulin signaling pathway
ssc04914  Progesterone-mediated oocyte maturation
ssc04915  Estrogen signaling pathway
ssc04917  Prolactin signaling pathway
ssc04919  Thyroid hormone signaling pathway
ssc04920  Adipocytokine signaling pathway
ssc04922  Glucagon signaling pathway
ssc04923  Regulation of lipolysis in adipocytes
ssc04926  Relaxin signaling pathway
ssc04929  GnRH secretion
ssc04931  Insulin resistance
ssc04932  Non-alcoholic fatty liver disease
ssc04933  AGE-RAGE signaling pathway in diabetic complications
ssc04935  Growth hormone synthesis, secretion and action
ssc04973  Carbohydrate digestion and absorption
ssc05010  Alzheimer disease
ssc05017  Spinocerebellar ataxia
ssc05132  Salmonella infection
ssc05135  Yersinia infection
ssc05142  Chagas disease
ssc05145  Toxoplasmosis
ssc05152  Tuberculosis
ssc05160  Hepatitis C
ssc05161  Hepatitis B
ssc05162  Measles
ssc05163  Human cytomegalovirus infection
ssc05164  Influenza A
ssc05165  Human papillomavirus infection
ssc05166  Human T-cell leukemia virus 1 infection
ssc05167  Kaposi sarcoma-associated herpesvirus infection
ssc05168  Herpes simplex virus 1 infection
ssc05169  Epstein-Barr virus infection
ssc05170  Human immunodeficiency virus 1 infection
ssc05200  Pathways in cancer
ssc05205  Proteoglycans in cancer
ssc05210  Colorectal cancer
ssc05211  Renal cell carcinoma
ssc05212  Pancreatic cancer
ssc05213  Endometrial cancer
ssc05214  Glioma
ssc05215  Prostate cancer
ssc05218  Melanoma
ssc05220  Chronic myeloid leukemia
ssc05221  Acute myeloid leukemia
ssc05222  Small cell lung cancer
ssc05223  Non-small cell lung cancer
ssc05224  Breast cancer
ssc05225  Hepatocellular carcinoma
ssc05226  Gastric cancer
ssc05230  Central carbon metabolism in cancer
ssc05231  Choline metabolism in cancer
ssc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ssc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100127478 (AKT2)
   04012 ErbB signaling pathway
    100127478 (AKT2)
   04014 Ras signaling pathway
    100127478 (AKT2)
   04015 Rap1 signaling pathway
    100127478 (AKT2)
   04370 VEGF signaling pathway
    100127478 (AKT2)
   04371 Apelin signaling pathway
    100127478 (AKT2)
   04630 JAK-STAT signaling pathway
    100127478 (AKT2)
   04668 TNF signaling pathway
    100127478 (AKT2)
   04066 HIF-1 signaling pathway
    100127478 (AKT2)
   04068 FoxO signaling pathway
    100127478 (AKT2)
   04072 Phospholipase D signaling pathway
    100127478 (AKT2)
   04071 Sphingolipid signaling pathway
    100127478 (AKT2)
   04024 cAMP signaling pathway
    100127478 (AKT2)
   04022 cGMP-PKG signaling pathway
    100127478 (AKT2)
   04151 PI3K-Akt signaling pathway
    100127478 (AKT2)
   04152 AMPK signaling pathway
    100127478 (AKT2)
   04150 mTOR signaling pathway
    100127478 (AKT2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100127478 (AKT2)
  09143 Cell growth and death
   04210 Apoptosis
    100127478 (AKT2)
   04218 Cellular senescence
    100127478 (AKT2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100127478 (AKT2)
   04550 Signaling pathways regulating pluripotency of stem cells
    100127478 (AKT2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100127478 (AKT2)
   04613 Neutrophil extracellular trap formation
    100127478 (AKT2)
   04620 Toll-like receptor signaling pathway
    100127478 (AKT2)
   04625 C-type lectin receptor signaling pathway
    100127478 (AKT2)
   04660 T cell receptor signaling pathway
    100127478 (AKT2)
   04662 B cell receptor signaling pathway
    100127478 (AKT2)
   04664 Fc epsilon RI signaling pathway
    100127478 (AKT2)
   04666 Fc gamma R-mediated phagocytosis
    100127478 (AKT2)
   04062 Chemokine signaling pathway
    100127478 (AKT2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100127478 (AKT2)
   04922 Glucagon signaling pathway
    100127478 (AKT2)
   04923 Regulation of lipolysis in adipocytes
    100127478 (AKT2)
   04920 Adipocytokine signaling pathway
    100127478 (AKT2)
   04929 GnRH secretion
    100127478 (AKT2)
   04915 Estrogen signaling pathway
    100127478 (AKT2)
   04914 Progesterone-mediated oocyte maturation
    100127478 (AKT2)
   04917 Prolactin signaling pathway
    100127478 (AKT2)
   04926 Relaxin signaling pathway
    100127478 (AKT2)
   04935 Growth hormone synthesis, secretion and action
    100127478 (AKT2)
   04919 Thyroid hormone signaling pathway
    100127478 (AKT2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100127478 (AKT2)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100127478 (AKT2)
  09156 Nervous system
   04725 Cholinergic synapse
    100127478 (AKT2)
   04728 Dopaminergic synapse
    100127478 (AKT2)
   04722 Neurotrophin signaling pathway
    100127478 (AKT2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100127478 (AKT2)
  09149 Aging
   04211 Longevity regulating pathway
    100127478 (AKT2)
   04213 Longevity regulating pathway - multiple species
    100127478 (AKT2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100127478 (AKT2)
   05205 Proteoglycans in cancer
    100127478 (AKT2)
   05230 Central carbon metabolism in cancer
    100127478 (AKT2)
   05231 Choline metabolism in cancer
    100127478 (AKT2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100127478 (AKT2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100127478 (AKT2)
   05212 Pancreatic cancer
    100127478 (AKT2)
   05225 Hepatocellular carcinoma
    100127478 (AKT2)
   05226 Gastric cancer
    100127478 (AKT2)
   05214 Glioma
    100127478 (AKT2)
   05221 Acute myeloid leukemia
    100127478 (AKT2)
   05220 Chronic myeloid leukemia
    100127478 (AKT2)
   05218 Melanoma
    100127478 (AKT2)
   05211 Renal cell carcinoma
    100127478 (AKT2)
   05215 Prostate cancer
    100127478 (AKT2)
   05213 Endometrial cancer
    100127478 (AKT2)
   05224 Breast cancer
    100127478 (AKT2)
   05222 Small cell lung cancer
    100127478 (AKT2)
   05223 Non-small cell lung cancer
    100127478 (AKT2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100127478 (AKT2)
   05017 Spinocerebellar ataxia
    100127478 (AKT2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100127478 (AKT2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100127478 (AKT2)
   04931 Insulin resistance
    100127478 (AKT2)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100127478 (AKT2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100127478 (AKT2)
   05135 Yersinia infection
    100127478 (AKT2)
   05152 Tuberculosis
    100127478 (AKT2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100127478 (AKT2)
   05170 Human immunodeficiency virus 1 infection
    100127478 (AKT2)
   05161 Hepatitis B
    100127478 (AKT2)
   05160 Hepatitis C
    100127478 (AKT2)
   05164 Influenza A
    100127478 (AKT2)
   05162 Measles
    100127478 (AKT2)
   05168 Herpes simplex virus 1 infection
    100127478 (AKT2)
   05163 Human cytomegalovirus infection
    100127478 (AKT2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100127478 (AKT2)
   05169 Epstein-Barr virus infection
    100127478 (AKT2)
   05165 Human papillomavirus infection
    100127478 (AKT2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100127478 (AKT2)
   05142 Chagas disease
    100127478 (AKT2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100127478 (AKT2)
   01524 Platinum drug resistance
    100127478 (AKT2)
   01522 Endocrine resistance
    100127478 (AKT2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ssc01001]
    100127478 (AKT2)
Enzymes [BR:ssc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100127478 (AKT2)
Protein kinases [BR:ssc01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   100127478 (AKT2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Kinase-like Pkinase_C
Other DBs
NCBI-GeneID: 100127478
NCBI-ProteinID: NP_001243708
Ensembl: ENSSSCG00000002989
Vega: OTTSUSG00000002304
UniProt: G9BWQ2
LinkDB
Position
6
AA seq 481 aa
MNEVSVIKEGWLHKRGEYIKTWRPRYFLLKSDGSFIGYKERPEAPDQTLPPLNNFSVAEC
QLMKTERPRPNTFVIRCLQWTTVIERTFHVDSPDEREEWMRAIQMVANSLKQRGAGEDPM
DYKCGSPSDSSAAEEMEVAVSKARAKVTMNDFDYLKLLGKGTFGKVILVREKATGRYYAM
KILRKEVIIAKDEVAHTVTESRVLQNTRHPFLTALKYAFQTHDRLCFVMEYANGGELFFH
LSRERVFTEERARFYGAEIVSALEYLHSRDVVYRDIKLENLMLDKDGHIKITDFGLCKEG
ISDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFE
LILMEEIRFPRTLSPEAKSLLAGLLKKDPKQRLGGGPSDAKEVMEHRFFLTVNWQDVVQK
KLLPPFKPQVTSEVDTRYFDDEFTAQSITITPPDRYDSLGSLELDQRTHFPQFSYSASIR
E
NT seq 1446 nt   +upstreamnt  +downstreamnt
atgaatgaggtgtctgtcatcaaagaaggctggctccacaagcgtggtgaatacatcaag
acctggaggccccggtacttcctgctgaagagtgacggctccttcattggctataaggag
cggcccgaggcccccgaccagaccctgccccccttaaacaacttctccgtagcagaatgc
cagctgatgaagaccgagagacctcggcccaacacctttgtcatacgctgcctgcagtgg
accacagtcatcgagaggaccttccatgtggactccccggatgagagggaggagtggatg
cgggccatccagatggttgccaacagcctcaagcagcggggcgcaggtgaggaccccatg
gactacaagtgtggctcccccagtgactcctctgctgctgaggagatggaagtggcagtg
agcaaggctcgggccaaggtgaccatgaacgacttcgactatctcaagctcctgggcaag
ggcacgttcggcaaagtcatcctggtgcgcgagaaggccaccggccgctactacgccatg
aagatcctgcggaaggaggttatcatcgccaaggatgaagtcgcccacacggtcaccgag
agccgggttctccagaacaccaggcacccgttcctcaccgcgctgaagtacgccttccag
acccacgaccgcctgtgcttcgtgatggagtacgccaacggtggcgagctgtttttccac
ctgtcccgggagcgcgtcttcacggaggagcgggcccgtttctacggcgcggagattgtc
tcggctctggagtacctgcactcgagggacgtggtgtaccgcgacatcaagctggaaaac
ctcatgctggacaaagacggccacatcaagatcacggacttcggcctgtgcaaagagggc
atcagtgatggggccaccatgaaaaccttctgtgggacccccgaatacctggcacccgag
gtgctggaggacaacgactacggccgggccgtggactggtgggggctgggcgtggtcatg
tacgagatgatgtgcggccgcctgcccttctacaaccaggaccacgagcgcctcttcgag
ctcatcctcatggaggagatccgcttcccgcgcacgctcagccccgaggccaagtccttg
cttgcggggctgcttaagaaggacccaaagcagaggctcggcggggggcccagcgatgcc
aaggaggtcatggagcacaggttcttcctcaccgtcaactggcaggacgtggtacagaag
aagctcctgccacccttcaaacctcaggtcacatctgaggtcgacactcggtactttgac
gatgaattcaccgcccaatccatcacaatcacgcccccggaccgctatgacagcctgggc
tcgctcgaactggaccagcggacccacttcccccagttctcctactcggccagcatccgg
gagtga

KEGG   Sus scrofa (pig): 100513811
Entry
100513811         CDS       T01009                                 

Gene name
AKT3
Definition
(RefSeq) RAC-gamma serine/threonine-protein kinase
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc01521  EGFR tyrosine kinase inhibitor resistance
ssc01522  Endocrine resistance
ssc01524  Platinum drug resistance
ssc04010  MAPK signaling pathway
ssc04012  ErbB signaling pathway
ssc04014  Ras signaling pathway
ssc04015  Rap1 signaling pathway
ssc04022  cGMP-PKG signaling pathway
ssc04024  cAMP signaling pathway
ssc04062  Chemokine signaling pathway
ssc04066  HIF-1 signaling pathway
ssc04068  FoxO signaling pathway
ssc04071  Sphingolipid signaling pathway
ssc04072  Phospholipase D signaling pathway
ssc04140  Autophagy - animal
ssc04150  mTOR signaling pathway
ssc04151  PI3K-Akt signaling pathway
ssc04152  AMPK signaling pathway
ssc04210  Apoptosis
ssc04211  Longevity regulating pathway
ssc04213  Longevity regulating pathway - multiple species
ssc04218  Cellular senescence
ssc04261  Adrenergic signaling in cardiomyocytes
ssc04370  VEGF signaling pathway
ssc04371  Apelin signaling pathway
ssc04380  Osteoclast differentiation
ssc04510  Focal adhesion
ssc04550  Signaling pathways regulating pluripotency of stem cells
ssc04611  Platelet activation
ssc04613  Neutrophil extracellular trap formation
ssc04620  Toll-like receptor signaling pathway
ssc04625  C-type lectin receptor signaling pathway
ssc04630  JAK-STAT signaling pathway
ssc04660  T cell receptor signaling pathway
ssc04662  B cell receptor signaling pathway
ssc04664  Fc epsilon RI signaling pathway
ssc04666  Fc gamma R-mediated phagocytosis
ssc04668  TNF signaling pathway
ssc04722  Neurotrophin signaling pathway
ssc04725  Cholinergic synapse
ssc04728  Dopaminergic synapse
ssc04910  Insulin signaling pathway
ssc04914  Progesterone-mediated oocyte maturation
ssc04915  Estrogen signaling pathway
ssc04917  Prolactin signaling pathway
ssc04919  Thyroid hormone signaling pathway
ssc04920  Adipocytokine signaling pathway
ssc04922  Glucagon signaling pathway
ssc04923  Regulation of lipolysis in adipocytes
ssc04926  Relaxin signaling pathway
ssc04929  GnRH secretion
ssc04931  Insulin resistance
ssc04932  Non-alcoholic fatty liver disease
ssc04933  AGE-RAGE signaling pathway in diabetic complications
ssc04935  Growth hormone synthesis, secretion and action
ssc04973  Carbohydrate digestion and absorption
ssc05010  Alzheimer disease
ssc05017  Spinocerebellar ataxia
ssc05132  Salmonella infection
ssc05135  Yersinia infection
ssc05142  Chagas disease
ssc05145  Toxoplasmosis
ssc05152  Tuberculosis
ssc05160  Hepatitis C
ssc05161  Hepatitis B
ssc05162  Measles
ssc05163  Human cytomegalovirus infection
ssc05164  Influenza A
ssc05165  Human papillomavirus infection
ssc05166  Human T-cell leukemia virus 1 infection
ssc05167  Kaposi sarcoma-associated herpesvirus infection
ssc05168  Herpes simplex virus 1 infection
ssc05169  Epstein-Barr virus infection
ssc05170  Human immunodeficiency virus 1 infection
ssc05200  Pathways in cancer
ssc05205  Proteoglycans in cancer
ssc05210  Colorectal cancer
ssc05211  Renal cell carcinoma
ssc05212  Pancreatic cancer
ssc05213  Endometrial cancer
ssc05214  Glioma
ssc05215  Prostate cancer
ssc05218  Melanoma
ssc05220  Chronic myeloid leukemia
ssc05221  Acute myeloid leukemia
ssc05222  Small cell lung cancer
ssc05223  Non-small cell lung cancer
ssc05224  Breast cancer
ssc05225  Hepatocellular carcinoma
ssc05226  Gastric cancer
ssc05230  Central carbon metabolism in cancer
ssc05231  Choline metabolism in cancer
ssc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ssc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100513811 (AKT3)
   04012 ErbB signaling pathway
    100513811 (AKT3)
   04014 Ras signaling pathway
    100513811 (AKT3)
   04015 Rap1 signaling pathway
    100513811 (AKT3)
   04370 VEGF signaling pathway
    100513811 (AKT3)
   04371 Apelin signaling pathway
    100513811 (AKT3)
   04630 JAK-STAT signaling pathway
    100513811 (AKT3)
   04668 TNF signaling pathway
    100513811 (AKT3)
   04066 HIF-1 signaling pathway
    100513811 (AKT3)
   04068 FoxO signaling pathway
    100513811 (AKT3)
   04072 Phospholipase D signaling pathway
    100513811 (AKT3)
   04071 Sphingolipid signaling pathway
    100513811 (AKT3)
   04024 cAMP signaling pathway
    100513811 (AKT3)
   04022 cGMP-PKG signaling pathway
    100513811 (AKT3)
   04151 PI3K-Akt signaling pathway
    100513811 (AKT3)
   04152 AMPK signaling pathway
    100513811 (AKT3)
   04150 mTOR signaling pathway
    100513811 (AKT3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100513811 (AKT3)
  09143 Cell growth and death
   04210 Apoptosis
    100513811 (AKT3)
   04218 Cellular senescence
    100513811 (AKT3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100513811 (AKT3)
   04550 Signaling pathways regulating pluripotency of stem cells
    100513811 (AKT3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100513811 (AKT3)
   04613 Neutrophil extracellular trap formation
    100513811 (AKT3)
   04620 Toll-like receptor signaling pathway
    100513811 (AKT3)
   04625 C-type lectin receptor signaling pathway
    100513811 (AKT3)
   04660 T cell receptor signaling pathway
    100513811 (AKT3)
   04662 B cell receptor signaling pathway
    100513811 (AKT3)
   04664 Fc epsilon RI signaling pathway
    100513811 (AKT3)
   04666 Fc gamma R-mediated phagocytosis
    100513811 (AKT3)
   04062 Chemokine signaling pathway
    100513811 (AKT3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100513811 (AKT3)
   04922 Glucagon signaling pathway
    100513811 (AKT3)
   04923 Regulation of lipolysis in adipocytes
    100513811 (AKT3)
   04920 Adipocytokine signaling pathway
    100513811 (AKT3)
   04929 GnRH secretion
    100513811 (AKT3)
   04915 Estrogen signaling pathway
    100513811 (AKT3)
   04914 Progesterone-mediated oocyte maturation
    100513811 (AKT3)
   04917 Prolactin signaling pathway
    100513811 (AKT3)
   04926 Relaxin signaling pathway
    100513811 (AKT3)
   04935 Growth hormone synthesis, secretion and action
    100513811 (AKT3)
   04919 Thyroid hormone signaling pathway
    100513811 (AKT3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100513811 (AKT3)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100513811 (AKT3)
  09156 Nervous system
   04725 Cholinergic synapse
    100513811 (AKT3)
   04728 Dopaminergic synapse
    100513811 (AKT3)
   04722 Neurotrophin signaling pathway
    100513811 (AKT3)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100513811 (AKT3)
  09149 Aging
   04211 Longevity regulating pathway
    100513811 (AKT3)
   04213 Longevity regulating pathway - multiple species
    100513811 (AKT3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100513811 (AKT3)
   05205 Proteoglycans in cancer
    100513811 (AKT3)
   05230 Central carbon metabolism in cancer
    100513811 (AKT3)
   05231 Choline metabolism in cancer
    100513811 (AKT3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100513811 (AKT3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100513811 (AKT3)
   05212 Pancreatic cancer
    100513811 (AKT3)
   05225 Hepatocellular carcinoma
    100513811 (AKT3)
   05226 Gastric cancer
    100513811 (AKT3)
   05214 Glioma
    100513811 (AKT3)
   05221 Acute myeloid leukemia
    100513811 (AKT3)
   05220 Chronic myeloid leukemia
    100513811 (AKT3)
   05218 Melanoma
    100513811 (AKT3)
   05211 Renal cell carcinoma
    100513811 (AKT3)
   05215 Prostate cancer
    100513811 (AKT3)
   05213 Endometrial cancer
    100513811 (AKT3)
   05224 Breast cancer
    100513811 (AKT3)
   05222 Small cell lung cancer
    100513811 (AKT3)
   05223 Non-small cell lung cancer
    100513811 (AKT3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100513811 (AKT3)
   05017 Spinocerebellar ataxia
    100513811 (AKT3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100513811 (AKT3)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100513811 (AKT3)
   04931 Insulin resistance
    100513811 (AKT3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100513811 (AKT3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100513811 (AKT3)
   05135 Yersinia infection
    100513811 (AKT3)
   05152 Tuberculosis
    100513811 (AKT3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100513811 (AKT3)
   05170 Human immunodeficiency virus 1 infection
    100513811 (AKT3)
   05161 Hepatitis B
    100513811 (AKT3)
   05160 Hepatitis C
    100513811 (AKT3)
   05164 Influenza A
    100513811 (AKT3)
   05162 Measles
    100513811 (AKT3)
   05168 Herpes simplex virus 1 infection
    100513811 (AKT3)
   05163 Human cytomegalovirus infection
    100513811 (AKT3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100513811 (AKT3)
   05169 Epstein-Barr virus infection
    100513811 (AKT3)
   05165 Human papillomavirus infection
    100513811 (AKT3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100513811 (AKT3)
   05142 Chagas disease
    100513811 (AKT3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100513811 (AKT3)
   01524 Platinum drug resistance
    100513811 (AKT3)
   01522 Endocrine resistance
    100513811 (AKT3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ssc01001]
    100513811 (AKT3)
Enzymes [BR:ssc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100513811 (AKT3)
Protein kinases [BR:ssc01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   100513811 (AKT3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Pkinase_C Kinase-like FTA2 PH_11
Other DBs
NCBI-GeneID: 100513811
NCBI-ProteinID: NP_001243075
Ensembl: ENSSSCG00000010872
Vega: OTTSUSG00000000913
UniProt: A0A4X1T5S8 G9BWQ3
LinkDB
Position
10
AA seq 479 aa
MSDVTIVKEGWVQKRGEYIKNWRPRYFLLKTDGSFIGYKEKPQDVDLPYPLNNFSVAKCQ
LMKTERPKPNTFIIRCLQWTTVIERTFHVDTPEEREEWTEAIQAVADRLQRQEEERMNCS
PTSQIDNIGEEEMDASTTHHKRKTMNDFDYLKLLGKGTFGKVILVREKASGKYYAMKILK
KEVIIAKDEVAHTLTESRVLKNTRHPFLTSLKYSFQTKDRLCFVMEYVNGGELFFHLSRE
RVFSEDRTRFYGAEIVSALDYLHSGKIVYRDLKLENLMLDKDGHIKITDFGLCKEGITDA
ATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILM
EDIKFPRTLSSDAKSLLSGLLIKDPNKRLGGGPDDAKEIMRHSFFSGVNWQDVYDKKLVP
PFKPQVTSETDTRYFDEEFTAQTITITPPEKYDEDGMDCMDNERRPHFPQFSYSASGRE
NT seq 1440 nt   +upstreamnt  +downstreamnt
atgagcgatgttaccattgtgaaggaaggttgggttcagaagaggggagaatatataaaa
aactggaggccaagatatttccttttgaagacagatggctcattcataggatataaagag
aaacctcaagatgtggatttaccttatcccctcaacaacttttcagtagcaaaatgccag
ttaatgaaaacagaacgaccaaagccaaacacatttattatcagatgtcttcagtggacc
actgttatagagagaacatttcatgtagatactccagaggaaagggaagaatggacagaa
gctatccaggctgtagcagacagacttcagaggcaagaggaggagagaatgaattgtagt
ccaacttcacaaattgataatataggagaggaagagatggatgcttctacaacccatcat
aaaagaaagacaatgaatgattttgactatttgaaactactaggtaaaggcactttcggg
aaagttattttggttcgagagaaggcgagtgggaaatactatgctatgaagattctgaaa
aaagaagttattattgccaaggatgaagtggcacacactttaactgaaagcagagtatta
aagaacactagacatccttttttaacatccttgaaatattccttccagacaaaagaccgt
ttgtgttttgtgatggaatatgttaatgggggagagctgtttttccatttgtcgagagag
cgggtgttctctgaggaccgcacacgtttctatggtgcagaaattgtctctgccttggac
tatctacattccggaaagattgtgtaccgggatctcaagttggagaatctgatgctggat
aaagatggccacataaaaattacagattttggactttgcaaagaagggatcacagatgca
gccaccatgaagacgttctgtggtacaccagaatatctggcaccagaggtgttagaagat
aatgactatggccgagccgtggattggtggggccttggggttgtcatgtatgaaatgatg
tgtgggaggttacctttctacaaccaggatcacgagaaactttttgaactaattctaatg
gaagacattaaatttcctcgaacactctcttcagatgcaaaatcattgctttcagggctc
ttgataaaggatccaaataaacgccttggtggaggaccagatgatgcaaaggagattatg
aggcacagtttcttctctggagtaaactggcaagatgtatatgataaaaagcttgtacct
ccttttaagcctcaagtaacatctgagacagacaccagatattttgatgaagaatttaca
gctcagactattacaataacaccacctgaaaaatatgatgaggacggaatggactgcatg
gacaatgagaggcggccgcacttccctcagttttcctactctgcaagtggacgagaataa

DBGET integrated database retrieval system