KEGG   Sus scrofa (pig): 100127158
Entry
100127158         CDS       T01009                                 

Gene name
RPS6KB1
Definition
(RefSeq) ribosomal protein S6 kinase beta-1 isoform X1
  KO
K04688  ribosomal protein S6 kinase beta [EC:2.7.11.1]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc01521  EGFR tyrosine kinase inhibitor resistance
ssc01522  Endocrine resistance
ssc04012  ErbB signaling pathway
ssc04066  HIF-1 signaling pathway
ssc04140  Autophagy - animal
ssc04150  mTOR signaling pathway
ssc04151  PI3K-Akt signaling pathway
ssc04152  AMPK signaling pathway
ssc04211  Longevity regulating pathway
ssc04213  Longevity regulating pathway - multiple species
ssc04350  TGF-beta signaling pathway
ssc04371  Apelin signaling pathway
ssc04666  Fc gamma R-mediated phagocytosis
ssc04714  Thermogenesis
ssc04910  Insulin signaling pathway
ssc04931  Insulin resistance
ssc05163  Human cytomegalovirus infection
ssc05165  Human papillomavirus infection
ssc05170  Human immunodeficiency virus 1 infection
ssc05200  Pathways in cancer
ssc05205  Proteoglycans in cancer
ssc05210  Colorectal cancer
ssc05212  Pancreatic cancer
ssc05221  Acute myeloid leukemia
ssc05224  Breast cancer
ssc05225  Hepatocellular carcinoma
ssc05226  Gastric cancer
ssc05231  Choline metabolism in cancer
ssc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100127158 (RPS6KB1)
   04350 TGF-beta signaling pathway
    100127158 (RPS6KB1)
   04371 Apelin signaling pathway
    100127158 (RPS6KB1)
   04066 HIF-1 signaling pathway
    100127158 (RPS6KB1)
   04151 PI3K-Akt signaling pathway
    100127158 (RPS6KB1)
   04152 AMPK signaling pathway
    100127158 (RPS6KB1)
   04150 mTOR signaling pathway
    100127158 (RPS6KB1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100127158 (RPS6KB1)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    100127158 (RPS6KB1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100127158 (RPS6KB1)
  09149 Aging
   04211 Longevity regulating pathway
    100127158 (RPS6KB1)
   04213 Longevity regulating pathway - multiple species
    100127158 (RPS6KB1)
  09159 Environmental adaptation
   04714 Thermogenesis
    100127158 (RPS6KB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100127158 (RPS6KB1)
   05205 Proteoglycans in cancer
    100127158 (RPS6KB1)
   05231 Choline metabolism in cancer
    100127158 (RPS6KB1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100127158 (RPS6KB1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100127158 (RPS6KB1)
   05212 Pancreatic cancer
    100127158 (RPS6KB1)
   05225 Hepatocellular carcinoma
    100127158 (RPS6KB1)
   05226 Gastric cancer
    100127158 (RPS6KB1)
   05221 Acute myeloid leukemia
    100127158 (RPS6KB1)
   05224 Breast cancer
    100127158 (RPS6KB1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100127158 (RPS6KB1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100127158 (RPS6KB1)
   05163 Human cytomegalovirus infection
    100127158 (RPS6KB1)
   05165 Human papillomavirus infection
    100127158 (RPS6KB1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100127158 (RPS6KB1)
   01522 Endocrine resistance
    100127158 (RPS6KB1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ssc01001]
    100127158 (RPS6KB1)
Enzymes [BR:ssc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100127158 (RPS6KB1)
Protein kinases [BR:ssc01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   100127158 (RPS6KB1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_C Kinase-like Pkinase_fungal APH
Other DBs
NCBI-GeneID: 100127158
NCBI-ProteinID: XP_003131719
Ensembl: ENSSSCG00000017670
UniProt: A0A481C7T7 A0A4X1STL0
LinkDB
Position
12
AA seq 525 aa
MRRRRRRDGFYPAPDFRDREAEDMAGVFDIDLDQPEDAGSEDELEEGGQLNESMDHGGVG
PYELGMEHCEKFEISETSVNRGPEKIRPECFELLRVLGKGGYGKVFQVRKVTGANTGKIF
AMKVLKKAMIVRNAKDTAHTKAERNILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGEL
FMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNHQGHVKLTDFGLC
KESIHDGTVTHTFCGTIEYMAPEILMRSGHNRAVDWWSLGALMYDMLTGAPPFTGENRKK
TIDKILKCKLNLPPYLTQEARDLLKKLLKRNAASRLGAGPGDAGEVQVHPFFRHINWEEL
LARKVEPPFKPLLQSEEDVSQFDSKFTRQTPVDSPDDSTLSESANQVFLGFTYVAPSVLE
SVKEKFSFEPKIRSPRRFIGSPRTPVSPVKFSAGDFWGRGASASTANPQTPVEYPMETSG
IEQMDVTMSGEASAPLPIRQPNSGPYKKQAFPMISKRPEHLRMNL
NT seq 1578 nt   +upstreamnt  +downstreamnt
atgaggcgacgacggaggcgggacggcttttacccagcgccggacttccgagacagggaa
gctgaggacatggcaggagtgtttgacatagacctggatcagccagaggacgcgggctct
gaggatgagctggaggaggggggtcagttaaatgaaagcatggaccatgggggagttgga
ccatatgaacttggcatggagcattgtgagaaatttgaaatctcagaaactagtgtgaac
agagggccagaaaaaataagaccagaatgttttgagctacttcgggtacttggtaaaggg
ggctatggaaaggtttttcaagtacgaaaagtaacaggagcaaataccgggaaaatattt
gccatgaaggtgcttaaaaaggcaatgatagtaagaaatgctaaagatacagctcataca
aaagcagaacggaatattctggaggaagtaaagcatcccttcattgtggatttaatttat
gcctttcagactggtggaaaactctacctcatccttgagtatctcagcggaggagaatta
tttatgcagttagaaagagagggaatatttatggaagacactgcctgcttttacttggca
gaaatttccatggctttgggacatttacatcaaaaggggatcatctacagagacctgaag
ccggagaatatcatgcttaatcaccaaggtcatgtgaaattaacagattttggactatgc
aaagaatctattcatgatggaacagtcacacacacattttgtggaacaatagaatacatg
gcccctgaaatcttgatgagaagtggccacaatcgtgccgtggattggtggagtttggga
gcattaatgtatgacatgctgactggagcacccccgttcactggggagaatagaaagaaa
acaattgacaaaatcctcaaatgtaagctcaatttgcctccctacctcacacaagaagcc
agagatctgcttaaaaagctgctgaaaagaaatgctgcttctcgtcttggagctggtcct
ggggacgctggagaagttcaagttcatccattctttagacatattaactgggaagaactg
cttgctcggaaggtggagcccccttttaaacctctgttgcaatctgaagaggatgtgagt
caatttgattcaaagtttacacgtcaaacacctgttgacagcccagatgactcaactctc
agtgaaagtgccaaccaggtctttctgggttttacatatgtggctccatctgtacttgaa
agtgtgaaagagaagttttcctttgaaccaaaaatccggtcacctcgaagatttattgga
agcccacgaacacctgtcagcccagtcaaattttctgctggggatttctggggaagaggt
gcttcagccagcacggcaaatcctcagactcctgtggaatacccaatggaaacaagtgga
atagagcagatggatgtgacgatgagcggggaagcttctgcaccacttccaatacgacag
ccgaactccgggccatacaaaaaacaagcttttcccatgatctccaaacgaccagagcac
ctgcgtatgaatctatga

KEGG   Sus scrofa (pig): 100512153
Entry
100512153         CDS       T01009                                 

Gene name
RPS6KB2
Definition
(RefSeq) ribosomal protein S6 kinase beta-2 isoform X1
  KO
K04688  ribosomal protein S6 kinase beta [EC:2.7.11.1]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc01521  EGFR tyrosine kinase inhibitor resistance
ssc01522  Endocrine resistance
ssc04012  ErbB signaling pathway
ssc04066  HIF-1 signaling pathway
ssc04140  Autophagy - animal
ssc04150  mTOR signaling pathway
ssc04151  PI3K-Akt signaling pathway
ssc04152  AMPK signaling pathway
ssc04211  Longevity regulating pathway
ssc04213  Longevity regulating pathway - multiple species
ssc04350  TGF-beta signaling pathway
ssc04371  Apelin signaling pathway
ssc04666  Fc gamma R-mediated phagocytosis
ssc04714  Thermogenesis
ssc04910  Insulin signaling pathway
ssc04931  Insulin resistance
ssc05163  Human cytomegalovirus infection
ssc05165  Human papillomavirus infection
ssc05170  Human immunodeficiency virus 1 infection
ssc05200  Pathways in cancer
ssc05205  Proteoglycans in cancer
ssc05210  Colorectal cancer
ssc05212  Pancreatic cancer
ssc05221  Acute myeloid leukemia
ssc05224  Breast cancer
ssc05225  Hepatocellular carcinoma
ssc05226  Gastric cancer
ssc05231  Choline metabolism in cancer
ssc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100512153 (RPS6KB2)
   04350 TGF-beta signaling pathway
    100512153 (RPS6KB2)
   04371 Apelin signaling pathway
    100512153 (RPS6KB2)
   04066 HIF-1 signaling pathway
    100512153 (RPS6KB2)
   04151 PI3K-Akt signaling pathway
    100512153 (RPS6KB2)
   04152 AMPK signaling pathway
    100512153 (RPS6KB2)
   04150 mTOR signaling pathway
    100512153 (RPS6KB2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100512153 (RPS6KB2)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    100512153 (RPS6KB2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100512153 (RPS6KB2)
  09149 Aging
   04211 Longevity regulating pathway
    100512153 (RPS6KB2)
   04213 Longevity regulating pathway - multiple species
    100512153 (RPS6KB2)
  09159 Environmental adaptation
   04714 Thermogenesis
    100512153 (RPS6KB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100512153 (RPS6KB2)
   05205 Proteoglycans in cancer
    100512153 (RPS6KB2)
   05231 Choline metabolism in cancer
    100512153 (RPS6KB2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100512153 (RPS6KB2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100512153 (RPS6KB2)
   05212 Pancreatic cancer
    100512153 (RPS6KB2)
   05225 Hepatocellular carcinoma
    100512153 (RPS6KB2)
   05226 Gastric cancer
    100512153 (RPS6KB2)
   05221 Acute myeloid leukemia
    100512153 (RPS6KB2)
   05224 Breast cancer
    100512153 (RPS6KB2)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100512153 (RPS6KB2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100512153 (RPS6KB2)
   05163 Human cytomegalovirus infection
    100512153 (RPS6KB2)
   05165 Human papillomavirus infection
    100512153 (RPS6KB2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100512153 (RPS6KB2)
   01522 Endocrine resistance
    100512153 (RPS6KB2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ssc01001]
    100512153 (RPS6KB2)
Enzymes [BR:ssc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100512153 (RPS6KB2)
Protein kinases [BR:ssc01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   100512153 (RPS6KB2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_C Kinase-like Pkinase_fungal FTA2
Other DBs
NCBI-GeneID: 100512153
NCBI-ProteinID: XP_003122510
Ensembl: ENSSSCG00000012910
LinkDB
Position
2
AA seq 485 aa
MAAVFDLDLETEEGSEGEGEPEFSPADACPLAESRAAGLEPVGHYEEVELTETSVNPGPE
RIGPHCFELLRVLGKGNYGKVFQVRKVQGTNLGKIYAMKVLRKAKIVRNAKDTAHTRAER
NILESVKHPFIVELAYAFQTGGKLYLILECLSGGELFTRLEREGIFLEDTACFYLSEITL
ALGHLHSQGIIYRDLKPENVMLSSQGHIKLTDFGLCKESIHEGTVTHTFCGTIEYMAPEI
LVRSGHNRAVDWWSLGALMYDMLTGSPPFTAENRKKTMDKIIRGKLVLPPYLTPDARDLV
KKFLKRNPSQRIGGGPGDAADVQKHPFFRHINWEDLLARRVDPPFRPCLQSEEDVSQFDT
HFTRQTPVDSPDDTALSESANQAFLGFTYVAPSVLDSIKEGFSFQPKLRSPRRLNSSPRT
PVSPLKFSPFEGFRPSPGPPDPMEPPLPPLLPPPPPPPPSSTAPLPIRPPSGTKKSKRGR
GRPGR
NT seq 1458 nt   +upstreamnt  +downstreamnt
atggcggcggtgtttgacctggacctggagacggaggaaggcagcgagggcgaaggcgag
ccagagttcagcccggcggatgcgtgtccccttgccgagtcgagggcggctggcctggag
cctgtgggacactatgaggaggtggagctgacagaaaccagtgtaaacccgggccctgag
cgcattgggccccactgctttgagctgctgcgcgtgctgggcaagggcaactacggcaag
gtgttccaggtgagaaaggtgcagggcaccaacctgggcaaaatctatgccatgaaagtc
ttgaggaaggccaaaatcgtgcgcaatgccaaggacacagcccacacccgggctgagcgg
aacattctagagtcagtgaagcaccccttcattgtcgagctggcctatgccttccagact
ggtggcaaactctacctcatcctcgagtgccttagtggcggcgagctcttcacgcggctg
gagcgagagggcatcttcctggaagacacggcctgcttctacctgtcagagatcacgctg
gccctgggccacctccactcccaaggcatcatctaccgggacctcaaacctgagaacgtc
atgctcagcagccagggccacatcaagctgacggacttcggcctctgcaaggagtctatc
cacgagggcacggtcacccacaccttctgtggcaccatcgagtacatggcccctgagatt
ctggtgcgcagtggccacaaccgggcggtggactggtggagcctgggggccctgatgtac
gacatgctcactggatcgccacccttcactgcagagaaccggaagaaaaccatggacaag
atcatcagagggaagctggtgctgccaccctacctcaccccggatgcccgggaccttgtc
aaaaagtttctgaagaggaatcccagccaacggattgggggtggcccaggggacgccgcc
gacgtgcagaaacatcccttcttccggcacattaattgggaggacctcctggcccgccgc
gtggacccccctttccggccctgcctgcagtcggaggaggacgtgagccagtttgacacc
cacttcacgaggcagacgccggtggacagtccagatgacacggccctcagtgagagtgcc
aaccaggccttcctgggtttcacgtacgtggcgccctccgtcctggacagcatcaaggag
ggcttctccttccagcccaagctgcgctctccccggcgcctcaacagcagcccccggacc
cccgtcagccccctgaagttctcgcccttcgagggattccggcccagccccggcccgcca
gatcccatggagccccctctgcctcctctcctgcccccgccgcctcccccgccgccctca
agcactgcccccctccccatccgacccccctcaggaaccaagaagtccaagaggggccgc
gggcgccctgggcgctag

DBGET integrated database retrieval system