KEGG   Sus scrofa (pig): 100127359
Entry
100127359         CDS       T01009                                 

Gene name
MTOR
Definition
(RefSeq) serine/threonine-protein kinase mTOR
  KO
K07203  serine/threonine-protein kinase mTOR [EC:2.7.11.1]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc01521  EGFR tyrosine kinase inhibitor resistance
ssc01522  Endocrine resistance
ssc04012  ErbB signaling pathway
ssc04066  HIF-1 signaling pathway
ssc04072  Phospholipase D signaling pathway
ssc04136  Autophagy - other
ssc04140  Autophagy - animal
ssc04150  mTOR signaling pathway
ssc04151  PI3K-Akt signaling pathway
ssc04152  AMPK signaling pathway
ssc04211  Longevity regulating pathway
ssc04213  Longevity regulating pathway - multiple species
ssc04218  Cellular senescence
ssc04371  Apelin signaling pathway
ssc04613  Neutrophil extracellular trap formation
ssc04630  JAK-STAT signaling pathway
ssc04659  Th17 cell differentiation
ssc04714  Thermogenesis
ssc04910  Insulin signaling pathway
ssc04919  Thyroid hormone signaling pathway
ssc04920  Adipocytokine signaling pathway
ssc04930  Type II diabetes mellitus
ssc04931  Insulin resistance
ssc04935  Growth hormone synthesis, secretion and action
ssc05010  Alzheimer disease
ssc05014  Amyotrophic lateral sclerosis
ssc05016  Huntington disease
ssc05017  Spinocerebellar ataxia
ssc05022  Pathways of neurodegeneration - multiple diseases
ssc05163  Human cytomegalovirus infection
ssc05165  Human papillomavirus infection
ssc05167  Kaposi sarcoma-associated herpesvirus infection
ssc05168  Herpes simplex virus 1 infection
ssc05170  Human immunodeficiency virus 1 infection
ssc05200  Pathways in cancer
ssc05205  Proteoglycans in cancer
ssc05206  MicroRNAs in cancer
ssc05210  Colorectal cancer
ssc05212  Pancreatic cancer
ssc05214  Glioma
ssc05215  Prostate cancer
ssc05221  Acute myeloid leukemia
ssc05224  Breast cancer
ssc05225  Hepatocellular carcinoma
ssc05226  Gastric cancer
ssc05230  Central carbon metabolism in cancer
ssc05231  Choline metabolism in cancer
ssc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100127359 (MTOR)
   04371 Apelin signaling pathway
    100127359 (MTOR)
   04630 JAK-STAT signaling pathway
    100127359 (MTOR)
   04066 HIF-1 signaling pathway
    100127359 (MTOR)
   04072 Phospholipase D signaling pathway
    100127359 (MTOR)
   04151 PI3K-Akt signaling pathway
    100127359 (MTOR)
   04152 AMPK signaling pathway
    100127359 (MTOR)
   04150 mTOR signaling pathway
    100127359 (MTOR)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100127359 (MTOR)
   04136 Autophagy - other
    100127359 (MTOR)
  09143 Cell growth and death
   04218 Cellular senescence
    100127359 (MTOR)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    100127359 (MTOR)
   04659 Th17 cell differentiation
    100127359 (MTOR)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100127359 (MTOR)
   04920 Adipocytokine signaling pathway
    100127359 (MTOR)
   04935 Growth hormone synthesis, secretion and action
    100127359 (MTOR)
   04919 Thyroid hormone signaling pathway
    100127359 (MTOR)
  09149 Aging
   04211 Longevity regulating pathway
    100127359 (MTOR)
   04213 Longevity regulating pathway - multiple species
    100127359 (MTOR)
  09159 Environmental adaptation
   04714 Thermogenesis
    100127359 (MTOR)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100127359 (MTOR)
   05206 MicroRNAs in cancer
    100127359 (MTOR)
   05205 Proteoglycans in cancer
    100127359 (MTOR)
   05230 Central carbon metabolism in cancer
    100127359 (MTOR)
   05231 Choline metabolism in cancer
    100127359 (MTOR)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100127359 (MTOR)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100127359 (MTOR)
   05212 Pancreatic cancer
    100127359 (MTOR)
   05225 Hepatocellular carcinoma
    100127359 (MTOR)
   05226 Gastric cancer
    100127359 (MTOR)
   05214 Glioma
    100127359 (MTOR)
   05221 Acute myeloid leukemia
    100127359 (MTOR)
   05215 Prostate cancer
    100127359 (MTOR)
   05224 Breast cancer
    100127359 (MTOR)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100127359 (MTOR)
   05014 Amyotrophic lateral sclerosis
    100127359 (MTOR)
   05016 Huntington disease
    100127359 (MTOR)
   05017 Spinocerebellar ataxia
    100127359 (MTOR)
   05022 Pathways of neurodegeneration - multiple diseases
    100127359 (MTOR)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100127359 (MTOR)
   04931 Insulin resistance
    100127359 (MTOR)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100127359 (MTOR)
   05168 Herpes simplex virus 1 infection
    100127359 (MTOR)
   05163 Human cytomegalovirus infection
    100127359 (MTOR)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100127359 (MTOR)
   05165 Human papillomavirus infection
    100127359 (MTOR)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100127359 (MTOR)
   01522 Endocrine resistance
    100127359 (MTOR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ssc01001]
    100127359 (MTOR)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ssc04131]
    100127359 (MTOR)
Enzymes [BR:ssc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100127359 (MTOR)
Protein kinases [BR:ssc01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   100127359 (MTOR)
Membrane trafficking [BR:ssc04131]
 Autophagy
  Other autophagy associated proteins
   mTORC1 complex
    100127359 (MTOR)
SSDB
Motif
Pfam: FAT PI3_PI4_kinase DUF3385 FRB_dom FATC HEAT_2 V-ATPase_H_N UME EPSP_synthase HEAT_EZ Nipped-B_C
Other DBs
NCBI-GeneID: 100127359
NCBI-ProteinID: XP_003127632
Ensembl: ENSSSCG00000003413
UniProt: A0A4X1W882 F1RHR8
LinkDB
Position
6
AA seq 2548 aa
MLGTGPAAATTATTTSSNVSVLQQFASGLKSRNEETRAKAAKELQHYVTMELREMSQEES
TRFYDQLNHHIFELVSSSDANERKGGILAIASLIGVEGGNATRIGRFANYLRNLLPSNDP
VVMEMASKAIGRLAMAGDTFTAEYVEFEVKRALEWLGADRNEGRRHAAVLVLRELAVSVP
TFFFQQVQPFFDNIFVAVWDPKQAIREGAVAALRACLILTTQREPKEMQKPQWYRHTFEE
AEKGFDETLAKEKGMNRDDRIHGALLILNELVRISSMEGERLREEMEEITQQQLVHDKYC
KDLMGFGTKPRHITPFTSFQAVQPQQSNALVGLLGYSSHQGLLGFGASPSPAKSTLVESR
CCRDLMEEKFDQVCQWVLKCRNSKNSLIQMTILNLLPRLAAFRPSAFTDTQYLQDTMNHV
LSCVKKEKERTAAFQALGLLSVAVRSEFKVYLPRVLDIIRAALPPKDFAHKRQKAMQVDA
TVFTCISMLARAMGPGIQQDIKELLEPMLAVGLSPALTAVLYDLSRQIPQLKKDIQDGLL
KMLSLVLMHKPLRHPGMPKGLAHQLASPSLTTLPEASDVGSITLALRTLGSFEFEGHSLT
QFVRHCADHFLNSEHKEIRMEAARTCSRLLTPSVHLISGHAHVVSQTAVQVVADVLSKLL
VVGITDPDPDIRYCVLASLDERFDAHLAQAENLQALFVALNDQVFEIRELAICTVGRLSS
MNPAFVMPFLRKMLIQILTELEHSGIGRIKEQSARMLGHLVSNAPRLIRPYMEPILKALI
LKLKDPDPDPNPGVINNVLATIGELAQVSGLEMRKWVDELFIIIMDMLQDSSLLAKRQVA
LWTLGQLVASTGYVVEPYRKYPTLLEVLLNFLKTEQNQGTRREAIRVLGLLGALDPYKHK
VNIGMIDQSRDASAVSLSESKSSQDSSDYSTSEMLVNMGNLPLDEFYPAVSMVALMRIFR
DQSLSHHHTMVVQAITFIFKSLGLKCVQFLPQVMPTFLNVIRVCDGAIREFLFQQLGMLV
SFVKSHIRPYMDEIVTLMREFWVMNTSIQSTIILLIEQIVVALGGEFKLYLPQLIPHMLR
VFMHDNSPGRIVSIKLLAAIQLFGANLDDYLHLLLPPIVKLFDAPEVPLPSRKAALETVD
RLTESLDFTDYASRIIHPIVRTLDQSPELRPTAMDTLSSLVFQLGKKYQIFIPMVNKVLV
RHRINHQRYDILICRIVKGYTLADEEEDPLIYQHRMLRSGQGDALASGPVETGPMKKLHV
STINLQKAWGAARRVSKDDWLEWLRRLSLELLKDSSSPSLRSCWALAQAYNPMARDLFNA
AFVSCWSELNEDQQDELIRSIELALTSQDIAEVTQTLLNLAEFMEHSDKGPLPLRDDNGI
VLLGERAAKCRAYAKALHYKELEFQKGPTPAILESLISINNKLQQPEAAAGVLEYAMKHF
GELEIQATWYEKLHEWEDALVAYDKKMDTNKDDPELMLGRMRCLEALGEWGQLHQQCCEK
WTLVNDETQAKMARMAAAAAWGLGQWDSMEEYTCMIPRDTHDGAFYRAVLALHQDLFSLA
QQCIDKARDLLDAELTAMAGESYSRAYGAMVSCHMLSELEEVIQYKLVPERREIIRQIWW
ERLQGCQRIVEDWQRILMVRSLVVSPHEDMRTWLKYASLCGKSGRLALAHKTLVLLLGVD
PSRQLDHPLPTGHPQVTYAYMKNMWKSARKIDAFQHMQHFVQTMQQQAQRAIATEDQQHK
QELHKLMARCFLKLGEWQLNLQGINESTIPKVLQYYSAATEHDRSWYKAWHAWAVMNFEA
VLHYKHQNQARDEKKKLRHASGANITNAATAATTAATATATSTEGSNSESEAESTENSPT
PSPLQKKVTEDLSKTLLMYTVPAVQGFFRSISLSRGNNLQDTLRVLTLWFDYGHWPDVNE
ALVEGVKAIQIDTWLQVIPQLIARIDTPRPLVGRLIHQLLTDIGRYHPQALIYPLTVASK
STTTARHNAANKILKNMCEHSNTLVQQAMMVSEELIRVAILWHEMWHEGLEEASRLYFGE
RNVKGMFEVLEPLHAMMERGPQTLKETSFNQAYGRDLMEAQEWCRKYMKSGNVKDLTQAW
DLYYHVFRRISKQLPQLTSLELQYVSPKLLMCRDLELAVPGTYDPNQPIIRIQSIAPSLQ
VITSKQRPRKLTLMGSNGHEFVFLLKGHEDLRQDERVMQLFGLVNTLLANDPTSLRKNLS
IQRYAVIPLSTNSGLIGWVPHCDTLHALIRDYREKKKILLNIEHRIMLRMAPDYDHLTLM
QKVEVFEHAVNNTAGDDLAKLLWLKSPSSEVWFDRRTNYTRSLAVMSMVGYILGLGDRHP
SNLMLDRLSGKILHIDFGDCFEVAMTREKFPEKIPFRLTRMLTNAMEVTGLDGNYRITCH
TVMEVLREHKDSVMAVLEAFVYDPLLNWRLMDTNTKGNKRSRTRTDSYSAGQSVEILDGV
ELGEPAHKKTGTTVPESIHSFIGDGLVKPEALNKKAIQIINRVRDKLTGRDFSHDETLDV
PTQVELLIKQATSHENLCQCYIGWCPFW
NT seq 7647 nt   +upstreamnt  +downstreamnt
atgcttggaaccggacctgccgccgccaccacagcgaccaccacttccagcaacgtgagc
gtcctgcagcagtttgccagtggcctgaagagccggaatgaggagaccagggccaaagct
gccaaggaactccagcactatgtcaccatggagctccgagagatgagtcaagaggagtct
actcgtttctatgatcagctgaaccatcacatttttgaactggtttccagctcagatgcc
aatgagaggaaaggcggcatcttggccatagccagcctcataggagtggaaggcgggaat
gccacccgaatcggaagatttgccaactatcttcggaacctcctcccctccaatgacccc
gttgtcatggaaatggcatccaaggccattggtcgcctcgccatggcaggagacactttt
actgcagagtatgtggagtttgaggtgaagcgagccctggagtggctgggtgctgaccga
aacgagggccggagacacgcagctgtcctggtccttcgtgagctggccgtcagcgtcccc
accttcttcttccagcaagtgcagcccttctttgacaacatttttgtggctgtgtgggac
cccaaacaggccatccgggagggagctgtcgccgcgctccgtgcctgtctgatcctcacc
acccagcgagagccaaaggagatgcagaagccgcagtggtacaggcacacgttcgaagaa
gcagagaaagggtttgacgagaccttggccaaggagaagggcatgaaccgggacgaccgg
atccacggagccttgctgatcctcaacgagctggtccgcatcagcagcatggagggagag
cgcctgagagaagaaatggaagaaatcacacagcagcagttggtacatgacaagtactgc
aaggacctcatgggcttcgggacgaaacctcgtcacatcacccccttcaccagtttccag
gccgtgcagccccagcagtcaaacgccttggtgggactgctggggtacagctctcaccaa
ggcctcctggggtttggggcttcccccagcccagccaagtccacgctggtggagagtcgc
tgttgcagagacttgatggaggagaaattcgaccaggtgtgccagtgggtgctgaaatgc
aggaatagcaagaactcactgatccaaatgacaatccttaatttgctgccccgcttggct
gccttccgaccctctgccttcacagatacgcagtacctccaggacaccatgaaccatgtt
ctaagctgcgtcaagaaggagaaggaacggacagcagccttccaagccctagggctgctt
tctgtggctgtgaggtctgagttcaaggtctatttacctcgtgtgctggacatcatccga
gcagccttgcctcctaaggactttgctcataagagacagaaggccatgcaggtggacgcc
acagtgttcacctgcatcagcatgctggcccgggccatggggccaggcatccagcaggat
atcaaggagctgctggagcccatgctggcggtgggactgagccctgccctcacagctgtg
ctctacgacctgagccgtcagattccacagctgaaaaaggacatccaggatgggctcctg
aagatgctgtccctggtccttatgcacaaacccctgcggcacccgggcatgcccaagggc
ctggcccatcagctggcttcccccagcctcacgaccctccccgaggccagtgacgtgggc
agcattactcttgccctccgaactctcggcagttttgaattcgaaggccactctctgacc
cagttcgtccgccactgtgcggatcacttcctgaacagcgagcacaaggagatccgcatg
gaagccgcccgcacctgctcccgcctgcttacgccctccgtccacctcatcagcggccac
gctcacgtggtcagccagaccgcagtgcaggtggtggcggatgtgctcagcaagctgctc
gtggttgggataaccgatcctgaccccgacatccgctactgcgtcttggcgtccctggat
gagcgctttgacgcgcacctggcccaggcagagaatctgcaggccctgtttgtggccctg
aatgaccaggtgtttgagatccgggagctggccatctgcaccgtgggccggctcagcagc
atgaacccagccttcgtcatgcccttcctgcgcaagatgctcatccagattttgacggag
ctggagcacagtggcatcggaagaatcaaggagcagagtgcccgcatgctgggccacctg
gtctccaacgccccccgactcatccgcccctacatggagcccattctcaaggccttaatt
ttgaaactgaaagatccagaccctgatccaaaccccggagtgatcaacaacgtcttggct
acaatcggagagctggctcaggtcagtggcctagaaatgaggaagtgggtggatgaactt
tttattatcatcatggacatgctccaggactcctctctgttggccaaaaggcaggtggcc
ctgtggactctgggacagctggtggccagcactggctatgtggtggagccctacaggaag
taccccacattgctggaggtgctgctgaatttcctgaagactgagcagaaccagggtaca
cggcgagaggctatccgcgtgttagggctcttgggggccttggacccctacaagcacaaa
gtgaacattggcatgatcgaccagtcccgggacgcttctgccgtcagcctgtcagaatcc
aagtcaagtcaggactcctccgactacagcaccagtgagatgctggtcaacatggggaac
ctgcccctggacgagttctacccggccgtgtccatggtggccctgatgcggatcttccga
gaccagtccctctcccaccaccacaccatggtcgtccaggccatcaccttcatcttcaag
tccctggggctcaagtgtgtgcagttcctgccccaggtcatgcccacgttcctgaacgtc
attcgggtttgcgacggggccatccgggaatttctgttccagcaactggggatgctggtg
tcctttgtgaagagccacatcagaccttatatggatgagattgtcaccctcatgagagaa
ttctgggtcatgaacacctccatccagagcaccatcattcttctcattgagcagattgtg
gtagctcttgggggcgagtttaagctctacctgccccagctgatcccacacatgctccga
gtcttcatgcatgacaacagcccaggccgcatcgtctccatcaagttgctggccgcaatc
cagctgtttggcgccaacctggatgactatctgcatttgttgttgccccctattgtgaag
ttgtttgatgcccctgaagttccattgccatctcgaaaggcagcgctagagacagtggac
cgcctgacggagtccctggatttcactgactatgcctctcggatcatccacccgattgtg
cgaaccctggaccagagcccagaactccgtcccacggccatggacacgctctcttcgctc
gttttccagctggggaagaagtaccaaattttcattcccatggtgaacaaagttctggtg
cgacatcgcatcaaccatcagcgctacgatatcctcatctgcaggattgtcaagggctac
acccttgccgacgaagaagaggaccctttgatttaccagcatcggatgctgagaagtggc
caaggggacgcactggctagtggaccagtagagacaggacccatgaagaaattgcacgtc
agcaccatcaacctccaaaaggcctggggagctgccagaagggtctccaaagatgactgg
ttggaatggctgaggcggctgagcctggagctgctgaaggactcctcgtccccatccctg
cgctcgtgctgggccctggctcaggcctacaacccgatggccagggatctcttcaacgcg
gcctttgtgtcctgctggtctgagctgaacgaagaccagcaggatgagctcatcagaagc
atcgagctggccctcacctcccaggacatcgctgaagtcacacaaacgctcttaaacttg
gccgaattcatggaacacagtgacaagggccccctgccgttgagagatgacaatggcatt
gttctgctgggcgagagggccgccaagtgtcgagcatacgccaaggcgctgcactacaaa
gaactggagttccagaagggccccacccccgccatcctggagtctctcatcagcatcaat
aataagctacaacagccagaggcagctgccggggtcttggagtatgccatgaagcacttt
ggagagctggagatccaggctacctggtacgagaaactgcatgagtgggaggatgccctg
gtggcctacgacaagaagatggacaccaacaaggacgacccggagctgatgctgggccgc
atgcgctgcctcgaggccttgggggaatgggggcagctgcaccagcagtgctgtgagaag
tggaccctggtgaatgacgaaacccaagccaagatggcccggatggctgctgcggctgcc
tggggtctcggtcagtgggacagcatggaggagtacacctgtatgatccctcgggacacc
cacgatggggcgttttatagagccgtgctggccctgcatcaggacctcttctccttggcc
caacagtgcatcgacaaagcccgggacctgctggacgccgagctgactgcgatggcagga
gagagctacagccgggcctacggggccatggtctcctgccacatgctctccgagctggag
gaggttatccagtacaaacttgtccccgagcgacgagagatcatccgccagatctggtgg
gagagactacagggctgccagcggatcgtggaggactggcagaggatcctcatggtgcgc
tcgctcgtggtcagccctcacgaggacatgaggacatggctcaagtacgcgagcctgtgc
ggcaagagcggcaggctggctcttgctcacaagaccttggtgctgctcctgggagtggat
ccgtctcggcagctcgaccaccctctgcccacaggccacccccaggtgacctacgcctac
atgaagaacatgtggaagagcgcccgcaagatcgatgccttccagcacatgcagcacttt
gttcagaccatgcagcagcaagcccaacgcgccatcgccactgaggaccagcagcacaag
caggagctgcacaagctcatggcccgatgtttcctgaaacttggagagtggcagctgaac
cttcaggggatcaacgagagcacgatccctaaagtcctgcagtactacagcgccgccacg
gagcacgaccgtagctggtacaaggcctggcacgcgtgggcagtgatgaacttcgaagct
gtgctccattacaaacatcagaaccaagcccgcgacgagaagaagaagctgcgccacgcc
agcggggccaacatcactaacgcagccaccgcagccaccacagcggccaccgccacggcc
accagcactgagggcagcaacagcgagagcgaggccgagagcactgagaacagccccacc
ccgtctcctctgcagaagaaggtcactgaggatttgtccaaaaccctcttgatgtacacc
gtccctgctgtccagggtttcttccgttccatctctttgtcacgaggcaacaacctccag
gacacactcagagtcctcaccttatggtttgattatgggcactggccggatgtaaacgaa
gccttagtggaaggggtgaaagcgatccagattgatacctggttacaggtcatacctcag
ctcattgcaagaatcgatacgcccaggcccttggtggggcgtctcattcaccagcttctc
acagacatcggtcggtaccacccccaggccctcatctaccccctgacggtggcgtctaag
tccaccaccaccgcccggcacaacgcggccaacaagatcctgaagaacatgtgtgagcac
agcaacaccctggtgcagcaggccatgatggtgagcgaggagctgatccgagtggccatc
ctctggcacgagatgtggcacgaaggcctggaagaggcgtctcgcttgtacttcggggag
aggaacgtgaaaggcatgttcgaggtgctggagcccctgcacgccatgatggagcgggga
ccccagaccctgaaggagacctcctttaaccaggcatacggtcgagacttaatggaggcc
caggagtggtgcaggaagtacatgaaatccgggaacgtcaaggacctcacccaggcctgg
gacctctattaccacgtgttcaggcgcatctcgaagcagctgccgcagctcacatcccta
gagctgcagtatgtttcccccaaactcctgatgtgccgggaccttgaattggctgtgcca
ggaacctatgaccccaaccagcccatcattcgcattcagtccatagcgccgtctctgcag
gtcatcacgtccaagcagaggccccggaagctgacacttatgggcagcaacggccacgag
ttcgtcttcctcctgaagggccacgaagacctgcggcaggacgagcgcgtcatgcagctc
ttcggcctggtcaacacccttttggccaacgacccaacgtctctccgcaagaacctcagc
atccagaggtacgccgtcatccccttatccaccaactcgggcctcatcggctgggtcccc
cactgtgacacactgcacgccctcatccgggactacagggagaagaagaagatccttctc
aacatcgagcatcgcatcatgctgcggatggctccagactacgaccacctgaccctgatg
cagaaggttgaggtgttcgagcacgccgtcaacaacaccgccggcgatgacctggccaag
ctgctgtggctgaaaagccccagctccgaggtgtggtttgatcgaagaaccaactacact
cgctctttagcagtcatgtccatggttgggtatattttgggcctgggcgatagacaccca
tctaacctgatgctggaccggctgagcgggaagatcctgcacattgactttggggactgc
tttgaggttgctatgaccagagagaagttcccagagaagattccatttagactaacgaga
atgttgaccaatgctatggaggtcactggtctggatggcaactacaggatcacgtgccac
acggtcatggaagtgcttcgggaacacaaggacagcgtcatggccgtgctggaagccttc
gtctatgaccccttactgaactggaggctgatggacacaaacaccaaaggtaacaagcga
tcgcgcacaaggacggattcctactctgccggccagtcagtagaaattttggatggtgtg
gaacttggggaaccagcccataagaaaacggggaccacagtgccagaatctattcattcg
ttcattggagatggtttggtgaaaccggaggccctaaataagaaagctattcagattatt
aacagggttcgagataagctcactggtcgggacttttctcatgatgaaaccttggatgtc
ccaacgcaagtggagctgctcatcaaacaagccacatcccatgaaaacctctgccagtgc
tacatcggctggtgtcctttctggtaa

DBGET integrated database retrieval system