KEGG   Sus scrofa (pig): 100135665
Entry
100135665         CDS       T01009                                 

Gene name
RELA
Definition
(RefSeq) transcription factor p65
  KO
K04735  transcription factor p65
Organism
ssc  Sus scrofa (pig)
Pathway
ssc01523  Antifolate resistance
ssc04010  MAPK signaling pathway
ssc04014  Ras signaling pathway
ssc04024  cAMP signaling pathway
ssc04062  Chemokine signaling pathway
ssc04064  NF-kappa B signaling pathway
ssc04066  HIF-1 signaling pathway
ssc04071  Sphingolipid signaling pathway
ssc04137  Mitophagy - animal
ssc04151  PI3K-Akt signaling pathway
ssc04210  Apoptosis
ssc04211  Longevity regulating pathway
ssc04218  Cellular senescence
ssc04380  Osteoclast differentiation
ssc04620  Toll-like receptor signaling pathway
ssc04621  NOD-like receptor signaling pathway
ssc04622  RIG-I-like receptor signaling pathway
ssc04623  Cytosolic DNA-sensing pathway
ssc04625  C-type lectin receptor signaling pathway
ssc04657  IL-17 signaling pathway
ssc04658  Th1 and Th2 cell differentiation
ssc04659  Th17 cell differentiation
ssc04660  T cell receptor signaling pathway
ssc04662  B cell receptor signaling pathway
ssc04668  TNF signaling pathway
ssc04722  Neurotrophin signaling pathway
ssc04917  Prolactin signaling pathway
ssc04920  Adipocytokine signaling pathway
ssc04926  Relaxin signaling pathway
ssc04931  Insulin resistance
ssc04932  Non-alcoholic fatty liver disease
ssc04933  AGE-RAGE signaling pathway in diabetic complications
ssc05010  Alzheimer disease
ssc05022  Pathways of neurodegeneration - multiple diseases
ssc05030  Cocaine addiction
ssc05132  Salmonella infection
ssc05133  Pertussis
ssc05134  Legionellosis
ssc05135  Yersinia infection
ssc05140  Leishmaniasis
ssc05142  Chagas disease
ssc05145  Toxoplasmosis
ssc05146  Amoebiasis
ssc05152  Tuberculosis
ssc05160  Hepatitis C
ssc05161  Hepatitis B
ssc05162  Measles
ssc05163  Human cytomegalovirus infection
ssc05164  Influenza A
ssc05165  Human papillomavirus infection
ssc05166  Human T-cell leukemia virus 1 infection
ssc05167  Kaposi sarcoma-associated herpesvirus infection
ssc05168  Herpes simplex virus 1 infection
ssc05169  Epstein-Barr virus infection
ssc05170  Human immunodeficiency virus 1 infection
ssc05200  Pathways in cancer
ssc05202  Transcriptional misregulation in cancer
ssc05203  Viral carcinogenesis
ssc05212  Pancreatic cancer
ssc05215  Prostate cancer
ssc05220  Chronic myeloid leukemia
ssc05221  Acute myeloid leukemia
ssc05222  Small cell lung cancer
ssc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ssc05321  Inflammatory bowel disease
ssc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100135665 (RELA)
   04014 Ras signaling pathway
    100135665 (RELA)
   04064 NF-kappa B signaling pathway
    100135665 (RELA)
   04668 TNF signaling pathway
    100135665 (RELA)
   04066 HIF-1 signaling pathway
    100135665 (RELA)
   04071 Sphingolipid signaling pathway
    100135665 (RELA)
   04024 cAMP signaling pathway
    100135665 (RELA)
   04151 PI3K-Akt signaling pathway
    100135665 (RELA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    100135665 (RELA)
  09143 Cell growth and death
   04210 Apoptosis
    100135665 (RELA)
   04218 Cellular senescence
    100135665 (RELA)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100135665 (RELA)
   04621 NOD-like receptor signaling pathway
    100135665 (RELA)
   04622 RIG-I-like receptor signaling pathway
    100135665 (RELA)
   04623 Cytosolic DNA-sensing pathway
    100135665 (RELA)
   04625 C-type lectin receptor signaling pathway
    100135665 (RELA)
   04660 T cell receptor signaling pathway
    100135665 (RELA)
   04658 Th1 and Th2 cell differentiation
    100135665 (RELA)
   04659 Th17 cell differentiation
    100135665 (RELA)
   04657 IL-17 signaling pathway
    100135665 (RELA)
   04662 B cell receptor signaling pathway
    100135665 (RELA)
   04062 Chemokine signaling pathway
    100135665 (RELA)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100135665 (RELA)
   04917 Prolactin signaling pathway
    100135665 (RELA)
   04926 Relaxin signaling pathway
    100135665 (RELA)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100135665 (RELA)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100135665 (RELA)
  09149 Aging
   04211 Longevity regulating pathway
    100135665 (RELA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100135665 (RELA)
   05202 Transcriptional misregulation in cancer
    100135665 (RELA)
   05203 Viral carcinogenesis
    100135665 (RELA)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100135665 (RELA)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100135665 (RELA)
   05221 Acute myeloid leukemia
    100135665 (RELA)
   05220 Chronic myeloid leukemia
    100135665 (RELA)
   05215 Prostate cancer
    100135665 (RELA)
   05222 Small cell lung cancer
    100135665 (RELA)
  09163 Immune disease
   05321 Inflammatory bowel disease
    100135665 (RELA)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100135665 (RELA)
   05022 Pathways of neurodegeneration - multiple diseases
    100135665 (RELA)
  09165 Substance dependence
   05030 Cocaine addiction
    100135665 (RELA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100135665 (RELA)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100135665 (RELA)
   04931 Insulin resistance
    100135665 (RELA)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100135665 (RELA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100135665 (RELA)
   05135 Yersinia infection
    100135665 (RELA)
   05133 Pertussis
    100135665 (RELA)
   05134 Legionellosis
    100135665 (RELA)
   05152 Tuberculosis
    100135665 (RELA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100135665 (RELA)
   05170 Human immunodeficiency virus 1 infection
    100135665 (RELA)
   05162 Measles
    100135665 (RELA)
   05164 Influenza A
    100135665 (RELA)
   05161 Hepatitis B
    100135665 (RELA)
   05160 Hepatitis C
    100135665 (RELA)
   05168 Herpes simplex virus 1 infection
    100135665 (RELA)
   05163 Human cytomegalovirus infection
    100135665 (RELA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100135665 (RELA)
   05169 Epstein-Barr virus infection
    100135665 (RELA)
   05165 Human papillomavirus infection
    100135665 (RELA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100135665 (RELA)
   05145 Toxoplasmosis
    100135665 (RELA)
   05140 Leishmaniasis
    100135665 (RELA)
   05142 Chagas disease
    100135665 (RELA)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    100135665 (RELA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ssc03000]
    100135665 (RELA)
Transcription factors [BR:ssc03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    100135665 (RELA)
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer
Other DBs
NCBI-GeneID: 100135665
NCBI-ProteinID: NP_001107753
Ensembl: ENSSSCG00000012981
Vega: OTTSUSG00000002866
UniProt: B0LXP3 A0A4X1UL81
LinkDB
Position
2
AA seq 553 aa
MDDLFPLIFPSEPAPASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPT
IKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQC
VKKRDLEQAINQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPAGRPLRLPPVLS
HPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFS
QADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEE
KRKRTYETFKSIMKKSPFNGPTDPRPATRRIAVPSRSSASVPKPAPQPYPFTPSLSTINF
DEFTPMAFASGQIPGQTSALAPAPAPVLVQAPAPAPAPAMASALAQAPAPVPVLAPGLAQ
AVAPPAPKTNQAGEGTLTEALLQLQFDTDEDLGALLGNNTDPTVFTDLASVDNSEFQQLL
NQGVSMPPHTAEPMLMEYPEAITRLVTGSQRPPDPAPTPLGASGLTNGLLSGDEDFSSIA
DMDFSALLSQISS
NT seq 1662 nt   +upstreamnt  +downstreamnt
atggacgacctcttccccctcatcttcccctcggagccggccccggcctcgggcccctat
gtggagatcatcgagcagcccaagcagcggggcatgcgcttccgctacaagtgcgagggc
cgctcagccggcagtatcccgggcgagaggagcacggataccaccaagacccaccccacc
atcaagatcaatggctacacggggccagggacagtgcgcatctccctggtcaccaaggac
ccccctcaccggcctcacccccatgagctcgtggggaaagactgccgggatggcttctat
gaggctgagctctgcccagaccgctgcatccacagcttccagaacctggggatccagtgt
gtaaagaagcgggacctggaacaggccatcaatcagcgcatccagaccaacaacaacccc
ttccaagttcccatagaagagcagcgcggggactacgacctgaatgctgtgcggctctgc
ttccaggtgacagtgcgggacccagcaggcaggcccctccgcctgccgcctgtcctctct
caccccatctttgacaaccgtgcccccaacactgcagagctcaagatctgccgggtgaat
cggaactcggggagctgccttgggggcgatgagatcttcctgctgtgcgacaaggtgcag
aaagaggacatcgaggtgtatttcacgggcccgggctgggaggcccgaggctccttttca
caagccgacgtgcaccgacaagtggccatcgtgttccggacgcctccctacgcggacccc
agcctgcaggcccccgtgcgcgtctccatgcagctgcggcggccttcggatcgggagctc
agcgagcccatggaattccagtacttgccagacacagatgaccggcaccggattgaggag
aaacgcaaaaggacctatgagacctttaagagcatcatgaagaagagtcctttcaatgga
cccaccgacccccggcctgcaacccggcgcattgctgtgccttcccgcagctcagcttcc
gtccccaagccagctccccagccctatccctttacgccatctctcagcaccatcaacttt
gacgagttcacgcccatggcctttgcttctgggcagatcccaggccagacctcagccttg
gccccagcccctgccccagtcctggtccaggccccagccccggccccagccccagccatg
gcatcagctctggcccaggccccagcccctgtccccgtcctagcccccggccttgctcag
gctgtggccccgcctgcccctaaaaccaaccaggctggggaagggacactgacagaggcc
ctgctgcagctgcagtttgatactgatgaggacctgggggccctgctcggcaataacact
gacccgaccgtgttcacggacctggcatccgtcgacaactctgagtttcagcagctgctg
aaccagggtgtatccatgcccccccacacagctgagcccatgctgatggagtaccctgag
gctataactcgcttggtgacagggtcccagagaccccctgacccagctcccactcccctg
ggggcctctgggctcaccaacggtctcctctcgggggacgaagacttctcctccattgcg
gacatggacttctcagcccttctgagtcagatcagctcctaa

DBGET integrated database retrieval system