KEGG   Sus scrofa (pig): 100144516
Entry
100144516         CDS       T01009                                 

Gene name
ATF6B
Definition
(RefSeq) cyclic AMP-dependent transcription factor ATF-6 beta
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04022  cGMP-PKG signaling pathway
ssc04141  Protein processing in endoplasmic reticulum
ssc04151  PI3K-Akt signaling pathway
ssc04211  Longevity regulating pathway
ssc04261  Adrenergic signaling in cardiomyocytes
ssc04668  TNF signaling pathway
ssc04728  Dopaminergic synapse
ssc04911  Insulin secretion
ssc04915  Estrogen signaling pathway
ssc04918  Thyroid hormone synthesis
ssc04925  Aldosterone synthesis and secretion
ssc04926  Relaxin signaling pathway
ssc04927  Cortisol synthesis and secretion
ssc04928  Parathyroid hormone synthesis, secretion and action
ssc04934  Cushing syndrome
ssc04935  Growth hormone synthesis, secretion and action
ssc05020  Prion disease
ssc05030  Cocaine addiction
ssc05031  Amphetamine addiction
ssc05034  Alcoholism
ssc05161  Hepatitis B
ssc05163  Human cytomegalovirus infection
ssc05166  Human T-cell leukemia virus 1 infection
ssc05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100144516 (ATF6B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    100144516 (ATF6B)
   04022 cGMP-PKG signaling pathway
    100144516 (ATF6B)
   04151 PI3K-Akt signaling pathway
    100144516 (ATF6B)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100144516 (ATF6B)
   04915 Estrogen signaling pathway
    100144516 (ATF6B)
   04926 Relaxin signaling pathway
    100144516 (ATF6B)
   04935 Growth hormone synthesis, secretion and action
    100144516 (ATF6B)
   04918 Thyroid hormone synthesis
    100144516 (ATF6B)
   04928 Parathyroid hormone synthesis, secretion and action
    100144516 (ATF6B)
   04925 Aldosterone synthesis and secretion
    100144516 (ATF6B)
   04927 Cortisol synthesis and secretion
    100144516 (ATF6B)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100144516 (ATF6B)
  09156 Nervous system
   04728 Dopaminergic synapse
    100144516 (ATF6B)
  09149 Aging
   04211 Longevity regulating pathway
    100144516 (ATF6B)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100144516 (ATF6B)
  09164 Neurodegenerative disease
   05020 Prion disease
    100144516 (ATF6B)
  09165 Substance dependence
   05030 Cocaine addiction
    100144516 (ATF6B)
   05031 Amphetamine addiction
    100144516 (ATF6B)
   05034 Alcoholism
    100144516 (ATF6B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100144516 (ATF6B)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100144516 (ATF6B)
   05161 Hepatitis B
    100144516 (ATF6B)
   05163 Human cytomegalovirus infection
    100144516 (ATF6B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ssc03000]
    100144516 (ATF6B)
Transcription factors [BR:ssc03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    100144516 (ATF6B)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf GIT_CC DUF4407 ZapB YabA Docking
Other DBs
NCBI-GeneID: 100144516
NCBI-ProteinID: NP_001116575
Ensembl: ENSSSCG00000001430
Vega: OTTSUSG00000001349
UniProt: A5A8W0
LinkDB
Position
7
AA seq 698 aa
MAELMLLSEIADPTRFFTDNLLSPEDWDSTLYAGLDEVAEEPTQLFRCPEEDVPFGSSSL
DLGMDVSPPEPPWDPLPIFPDLQVKSEPSSPCSSSSLSSEASHLSTEPSSQASGVGEVLV
VKTESLAPPLCLLGDDPTSPFETVQINVGPTSDDPSDVQIKIEPVSPSSSINSEASVLSA
ESPNQTFIGEEVLEVKTESPSPQGCLLRDVPGPALGAVQITMGPSSDGSSGKALPTRKPP
LQPKPVVITTVPMPPRAVPPSTTVLLQPLVQPPPVSPVVLIQGAIRVQPEGPTPAAPRPE
RKSIVPAPMPGNSCPPEVDAKLLKRQQRMIKNRESACQSRRKKKEYLQGLEARLQAVLAD
NQQLRRENAALRRRLEALLAENSELRLGSGNRKVVCVMVFLLFIAFNFGPVSISEPPPAP
ISPRTSREEPRPRRHLLEFSAQEPAEPPRRPSQGLEEPQPSPAGRPSFRNLTAFPGAAKE
LLLRDLDQLFLSSDCRHFNRTESLRLADELSGWVQRHQRGRRKIPQRAQERQKSQLRKKS
PPIKAAVPTQSPGPPERDAARQLQLYRHPDRSQPEFLDAIDRREDTLYVVSFRRDHLLLP
AISHNKTSRPKMSLVMPAMAPNETLSGRGPPGDYEEMMQIECEVMDTRVIHIKTSTVPPS
LRKQPASTPGNATGGPLPASAASQASQAARQPLYLNHP
NT seq 2097 nt   +upstreamnt  +downstreamnt
atggcggagctgatgctcctcagcgagattgcggacccgacgcgttttttcaccgacaac
ttgctgagcccggaggactgggacagcaccttgtacgccggcctggatgaagtggccgag
gagccgacgcagcttttccgttgcccggaggaagatgtcccgtttggcagcagctccctg
gacttggggatggatgtcagccctcccgaacccccctgggaccctctgcctatcttccca
gatcttcaggtgaagtctgagccatcctccccctgctcttcctcctccctcagctctgaa
gcatcacatctttccacagagccctccagccaggcttctggtgtaggggaggtgctggtt
gtgaagacagagtccttggcgcccccactctgccttctgggagatgatccaacatcccct
tttgaaaccgtccagatcaatgtgggccccacctctgatgatccctcagatgtccaaatt
aagatagagcctgtctctccatcttcctccatcaactcggaggcgtccgtgctctcagca
gagtcccccaaccagacctttataggggaggaagtattagaagtgaagacagagtccccg
tcccctcaagggtgtctcctgcgggatgtcccaggccccgcacttggagctgtccagatc
accatgggcccgtcctccgatggctcctcaggcaaagctctgcccactcggaagccaccg
ctgcaacccaaacctgtggtgataaccactgtcccaatgccacccagagctgtgcctccc
agcaccactgtccttttgcagccccttgtccagccacccccagtgtccccagttgtcctc
atccaaggtgctattcgagtccagcctgagggaccgacccccgctgctccacggcctgag
aggaagagcattgttccggctcctatgcctgggaactcctgcccacccgaggtggatgcc
aagctgctgaagcggcagcagcgaatgatcaagaaccgggagtcagcctgccagtcccgg
aggaagaagaaggagtatctgcaggggctggaggcgcggctgcaggccgtgctggccgac
aaccagcagctccggcgggagaatgctgccctccgccggcggctggaggctctgctggcc
gagaacagcgagctcaggttggggtctggaaacaggaaggtggtctgcgtcatggtcttc
cttctcttcatcgccttcaacttcgggcccgtcagcatcagtgagcctccgccggcaccc
atctctcctcggacgagcagagaagagcctcgaccacgcagacacttgctggagttctca
gcacaggagccagccgagcccccccggcggccctcccagggcctggaggagccccagccc
agccctgcaggccggccaagtttcaggaacctgacagccttccctggggccgccaaggag
ctgctgctgagagacctggaccagctcttcctctcctctgattgccggcacttcaaccga
actgagtccttgaggcttgctgacgagctgagtggctgggtccagcggcaccagaggggc
cggcggaagatcccccagagggcccaggagaggcagaagtctcagctacggaagaagtca
cctccaattaaggcagcagtccccacccaatcccctgggcccccagaaagggacgctgcg
cgccaactgcagctgtatcgccacccagaccgttcacagccagagttcctggatgcaatc
gaccgacgggaagacacgctttacgttgtttccttccgaagggaccacctgttgctccca
gccatcagccacaacaagacctctcggcccaagatgtccctggtgatgcctgccatggcc
cccaatgagaccctgtcaggccgggggcccccgggggactatgaggagatgatgcagatc
gagtgtgaggtcatggacaccagggtgatccacatcaagacctccacagtgcccccctcg
ctccgaaaacagccagcctcaaccccgggcaatgccacaggtggccccttgccagcctct
gcagccagccaggccagccaggccgcccgtcagcccctctacctcaatcacccctga

DBGET integrated database retrieval system