KEGG   Sus scrofa (pig): 100151828
Entry
100151828         CDS       T01009                                 

Gene name
RB1
Definition
(RefSeq) retinoblastoma-associated protein
  KO
K06618  retinoblastoma-associated protein
Organism
ssc  Sus scrofa (pig)
Pathway
ssc01522  Endocrine resistance
ssc04110  Cell cycle
ssc04218  Cellular senescence
ssc04934  Cushing syndrome
ssc05160  Hepatitis C
ssc05161  Hepatitis B
ssc05163  Human cytomegalovirus infection
ssc05165  Human papillomavirus infection
ssc05166  Human T-cell leukemia virus 1 infection
ssc05167  Kaposi sarcoma-associated herpesvirus infection
ssc05169  Epstein-Barr virus infection
ssc05200  Pathways in cancer
ssc05203  Viral carcinogenesis
ssc05212  Pancreatic cancer
ssc05214  Glioma
ssc05215  Prostate cancer
ssc05218  Melanoma
ssc05219  Bladder cancer
ssc05220  Chronic myeloid leukemia
ssc05222  Small cell lung cancer
ssc05223  Non-small cell lung cancer
ssc05224  Breast cancer
ssc05225  Hepatocellular carcinoma
ssc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100151828 (RB1)
   04218 Cellular senescence
    100151828 (RB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100151828 (RB1)
   05203 Viral carcinogenesis
    100151828 (RB1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100151828 (RB1)
   05225 Hepatocellular carcinoma
    100151828 (RB1)
   05226 Gastric cancer
    100151828 (RB1)
   05214 Glioma
    100151828 (RB1)
   05220 Chronic myeloid leukemia
    100151828 (RB1)
   05218 Melanoma
    100151828 (RB1)
   05219 Bladder cancer
    100151828 (RB1)
   05215 Prostate cancer
    100151828 (RB1)
   05224 Breast cancer
    100151828 (RB1)
   05222 Small cell lung cancer
    100151828 (RB1)
   05223 Non-small cell lung cancer
    100151828 (RB1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100151828 (RB1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100151828 (RB1)
   05161 Hepatitis B
    100151828 (RB1)
   05160 Hepatitis C
    100151828 (RB1)
   05163 Human cytomegalovirus infection
    100151828 (RB1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100151828 (RB1)
   05169 Epstein-Barr virus infection
    100151828 (RB1)
   05165 Human papillomavirus infection
    100151828 (RB1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100151828 (RB1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ssc01009]
    100151828 (RB1)
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ssc03000]
    100151828 (RB1)
Protein phosphatases and associated proteins [BR:ssc01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100151828 (RB1)
Transcription factors [BR:ssc03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain Rb
    100151828 (RB1)
SSDB
Motif
Pfam: Rb_C RB_A RB_B DUF3452
Other DBs
NCBI-GeneID: 100151828
NCBI-ProteinID: NP_001272896
Ensembl: ENSSSCG00000009401
UniProt: J7FNA4
LinkDB
Position
11
AA seq 939 aa
MPPKTPRRAAAAAAAAAAAAAEPPPPPPPPPPPPPPPQPEEDPEQDSGPEDLPLVRLAFE
ETEEPDFTTLCQKLKIADHVRERAWLTWEKVSSVDGVLEGHIQKKKELWGICIFIAAVDL
DEMPFTFTELQKNIDISVYKFFDLLKEIDTSTKVDNAMSKLLKKYNVLCALYSKLERTCE
LIYLSQPSSSISTEINSMLVLKVSWITFLLAKGEVLQMEDDLVISFQLMLCVLDYFIKLS
PPALLKEPYKTAVIPINGSPRTPRRGQNRSARIAKQLENDTRIIEVLCKEHECNIDEVKN
VYFKNFIPFMNSLGIVASNGLPEVESLSKQYEEIYLKNKDLDARLFLNHDKTLQADPTDS
LEMQRTPRKSNPDEEVNVILPQTPVRTVMNTIQQLMMILNSASDQPSENLISYFNNCTVN
PKESILKRVKDIGYIFKEQFAKAVGQGCMEIGSQRYKLGVRLYYRVMESMLKSEEERLSI
QNFSKLLNDNIFHMSLLACALEVVMATYSRSTSQNLDTGTDLSFPWILNVLNLKAFDFYK
VIESFIKAEANLTREMIKHLERCEHRIMESLAWRSDSPLFDLIKQTKDREGPADHLESAC
TLINLPLQSNHTAADMYLSPLRSPKKKGSTTRVNSTANSEAQATSTFQTQKPLKSTSLSL
FYKKVYRLAYLRLNTLCARLLSDHPELEHIIWTLFQHTLQNEYELMRDRHLDQIMMCSMY
GICKVKNIDLKFKIIVTAYKDLPHAVQETFKRVLIREEEYDSIIVFYNSVFMQRLKTNIL
QYASTRPPTLSPIPHIPRSPYKFSSSPVRIPGGNIYISPLKNPYKISEGLPTPTKMTPRS
RILVSIGESFGTSEKFQKINQMVCNSDRVLKRSAEGGNPPKPLKKLRFDIEGADEADGSK
HLPGESKFQQKLAEMTSTRTRMQKQKMNDSMDTSNREEK
NT seq 2820 nt   +upstreamnt  +downstreamnt
atgccgcccaaaaccccccggagagcagccgccgccgccgccgccgccgccgctgctgct
gcggagcccccgccgccgccgccgccgccgccgccgccaccgccgccaccgcagcctgag
gaggaccccgagcaggacagcggccccgaggacctgcctctggtcaggcttgcatttgaa
gaaactgaagaacctgattttactacattatgtcagaaattaaagatagcagatcatgtc
agagaaagagcttggttaacttgggagaaagtttcatctgtggatggagtattggaaggt
catattcaaaagaaaaaggaactgtggggaatctgtatctttattgcagcagttgaccta
gatgaaatgccattcaccttcactgagctgcagaaaaacattgacatcagtgtctataaa
ttctttgacttattgaaagaaattgataccagtaccaaagttgataatgctatgtcaaaa
ctgttgaagaagtataatgtattgtgtgcactctacagcaaattagaaaggacatgtgaa
cttatatatttgtcacaacccagcagttcaatatctactgaaataaattctatgttggtg
ctaaaagtttcttggatcacatttttactagctaaaggggaagtattacaaatggaagat
gatctggtgatctcatttcagttaatgctatgtgttcttgactattttatcaaactctca
cctcctgcattgctcaaagaaccatataaaacagctgtaatacctattaatggttcacct
cgaacaccaaggcgaggtcagaacaggagtgcacggatagcaaaacaactagaaaatgat
acaagaattattgaagttctctgtaaagaacatgaatgtaatatagatgaggtgaaaaat
gtttatttcaaaaattttataccttttatgaattctcttggaattgtagcctctaatgga
cttccagaggtggaaagtctttctaaacaatatgaagaaatttaccttaaaaacaaagat
ctagatgccaggttatttttgaatcatgataaaactcttcaggctgatcctacagacagt
ttggaaatgcagagaacaccacgaaaaagtaaccctgatgaagaggtgaatgtgattctg
ccacagactccagttaggactgttatgaatactatccaacaattaatgatgatcttaaat
tcagcaagtgatcaaccatcagaaaatctgatttcctattttaataattgcaccgtgaat
ccaaaggaaagtatcttgaaaagagtaaaggatattggatacatctttaaagaacagttt
gctaaagctgtgggacagggatgcatggaaattggatcacagcgatacaaacttggagtc
cgattgtattaccgagtaatggaatccatgctcaaatccgaagaagaacgattatccatt
caaaattttagcaaactcctgaatgacaacatctttcatatgtctttgttggcatgcgct
cttgaggttgtaatggctacatatagcagaagtacgtctcagaatcttgatactggaaca
gatttgtccttcccgtggattctgaatgtacttaatttaaaagcttttgatttttacaaa
gtgattgaaagttttatcaaagcagaagccaacttgaccagagaaatgattaaacattta
gaacgatgtgaacatcgaatcatggaatcccttgcttggcgctcagattcacctttattt
gatcttattaaacaaacaaaggacagagaaggaccagctgatcaccttgaatctgcttgt
actcttattaaccttcctctccagagtaatcacactgcagcagatatgtatctttctcct
ttaagatcccccaagaaaaaagggtcaactacacgtgtaaattctactgcaaattcagag
gcacaagcaacctcaaccttccagactcagaagccactgaaatctacctccctttcactc
ttttacaaaaaagtgtaccgactagcatatcttcgactcaataccctgtgtgcacgcctt
ctgtctgaccacccagaactagagcatatcatctggacccttttccagcacacactgcaa
aatgagtatgaactcatgagagacaggcatttggaccagattatgatgtgttccatgtat
ggcatatgcaaagtgaagaacatagaccttaaattcaaaatcattgtaacagcatacaaa
gatcttcctcatgctgttcaggagacattcaaacgtgttttgatcagagaagaggagtat
gattctattatcgtattctataattcagtcttcatgcagagactgaaaacaaatattttg
cagtatgcttccaccaggccccccactttgtcaccaattcctcacattcctcggagccct
tacaagttttccagttcacctgtacggattcctggggggaacatctatatatcaccccta
aagaatccatataaaatttcagaaggcctgccaacgccaacaaaaatgactccaagatcg
agaatcttagtatcaattggtgaatcatttgggacttcggagaagttccagaaaataaat
cagatggtgtgtaatagcgaccgtgtgctcaaaagaagtgctgaaggaggcaaccctcct
aaacctctgaaaaagctgcgctttgacatcgaaggagcagatgaagcagatggaagtaaa
catctcccgggagagtctaaatttcaacagaaactggcagaaatgacatctactcgaaca
cgaatgcaaaagcagaaaatgaatgacagcatggatacctcgaacagggaagaaaagtga

DBGET integrated database retrieval system