KEGG   Sus scrofa (pig): 100152215
Entry
100152215         CDS       T01009                                 

Gene name
CDKN1A
Definition
(RefSeq) LOW QUALITY PROTEIN: cyclin-dependent kinase inhibitor 1
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
ssc  Sus scrofa (pig)
Pathway
ssc01522  Endocrine resistance
ssc01524  Platinum drug resistance
ssc04012  ErbB signaling pathway
ssc04066  HIF-1 signaling pathway
ssc04068  FoxO signaling pathway
ssc04110  Cell cycle
ssc04115  p53 signaling pathway
ssc04151  PI3K-Akt signaling pathway
ssc04218  Cellular senescence
ssc04630  JAK-STAT signaling pathway
ssc04921  Oxytocin signaling pathway
ssc04928  Parathyroid hormone synthesis, secretion and action
ssc04934  Cushing syndrome
ssc05160  Hepatitis C
ssc05161  Hepatitis B
ssc05163  Human cytomegalovirus infection
ssc05165  Human papillomavirus infection
ssc05166  Human T-cell leukemia virus 1 infection
ssc05167  Kaposi sarcoma-associated herpesvirus infection
ssc05169  Epstein-Barr virus infection
ssc05200  Pathways in cancer
ssc05202  Transcriptional misregulation in cancer
ssc05203  Viral carcinogenesis
ssc05205  Proteoglycans in cancer
ssc05206  MicroRNAs in cancer
ssc05210  Colorectal cancer
ssc05211  Renal cell carcinoma
ssc05212  Pancreatic cancer
ssc05213  Endometrial cancer
ssc05214  Glioma
ssc05215  Prostate cancer
ssc05216  Thyroid cancer
ssc05217  Basal cell carcinoma
ssc05218  Melanoma
ssc05219  Bladder cancer
ssc05220  Chronic myeloid leukemia
ssc05222  Small cell lung cancer
ssc05223  Non-small cell lung cancer
ssc05224  Breast cancer
ssc05225  Hepatocellular carcinoma
ssc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100152215 (CDKN1A)
   04630 JAK-STAT signaling pathway
    100152215 (CDKN1A)
   04066 HIF-1 signaling pathway
    100152215 (CDKN1A)
   04068 FoxO signaling pathway
    100152215 (CDKN1A)
   04151 PI3K-Akt signaling pathway
    100152215 (CDKN1A)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100152215 (CDKN1A)
   04115 p53 signaling pathway
    100152215 (CDKN1A)
   04218 Cellular senescence
    100152215 (CDKN1A)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100152215 (CDKN1A)
   04928 Parathyroid hormone synthesis, secretion and action
    100152215 (CDKN1A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100152215 (CDKN1A)
   05202 Transcriptional misregulation in cancer
    100152215 (CDKN1A)
   05206 MicroRNAs in cancer
    100152215 (CDKN1A)
   05205 Proteoglycans in cancer
    100152215 (CDKN1A)
   05203 Viral carcinogenesis
    100152215 (CDKN1A)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100152215 (CDKN1A)
   05212 Pancreatic cancer
    100152215 (CDKN1A)
   05225 Hepatocellular carcinoma
    100152215 (CDKN1A)
   05226 Gastric cancer
    100152215 (CDKN1A)
   05214 Glioma
    100152215 (CDKN1A)
   05216 Thyroid cancer
    100152215 (CDKN1A)
   05220 Chronic myeloid leukemia
    100152215 (CDKN1A)
   05217 Basal cell carcinoma
    100152215 (CDKN1A)
   05218 Melanoma
    100152215 (CDKN1A)
   05211 Renal cell carcinoma
    100152215 (CDKN1A)
   05219 Bladder cancer
    100152215 (CDKN1A)
   05215 Prostate cancer
    100152215 (CDKN1A)
   05213 Endometrial cancer
    100152215 (CDKN1A)
   05224 Breast cancer
    100152215 (CDKN1A)
   05222 Small cell lung cancer
    100152215 (CDKN1A)
   05223 Non-small cell lung cancer
    100152215 (CDKN1A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100152215 (CDKN1A)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100152215 (CDKN1A)
   05161 Hepatitis B
    100152215 (CDKN1A)
   05160 Hepatitis C
    100152215 (CDKN1A)
   05163 Human cytomegalovirus infection
    100152215 (CDKN1A)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100152215 (CDKN1A)
   05169 Epstein-Barr virus infection
    100152215 (CDKN1A)
   05165 Human papillomavirus infection
    100152215 (CDKN1A)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100152215 (CDKN1A)
   01522 Endocrine resistance
    100152215 (CDKN1A)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 100152215
NCBI-ProteinID: XP_013833312
LinkDB
Position
7
AA seq 164 aa
MSESTRDAHQIPRSSKACRRLFGPVDSEQLRQDCDALMASCVQEARERWNFDFITETPLE
GDFAWERVRGLGLPKIYLPTGPRGTWDDLGGGKRPSTSPALLQGTSQEDHVDLLLSCTLV
PHSPERPEGSPGGPAXSQGRKRRQTSMTDFYHSKRRLIFSKRKP
NT seq 495 nt   +upstreamnt  +downstreamnt
atgtcagagtcgaccagggatgcacatcagatcccgcgcagcagcaaggcctgccgccgc
ctctttggcccagtggacagtgagcagctgcgccaggactgcgatgcactgatggccagc
tgcgtgcaagaggcccgagagcgatggaacttcgacttcatcactgagacccccctggag
ggtgacttcgcctgggaacgtgtgcgaggccttggtctgcccaagatctacctgcccaca
gggccccgggggacctgggatgacctgggagggggcaagcggccaagcacctcgcctgcc
cttctgcaggggacgtctcaggaggaccatgtggacctgttgctgtcctgcacccttgtg
cctcactcccctgagcggcctgaggggtccccaggagggcctgcancctcccagggcagg
aaacggcggcagaccagcatgacagatttctaccactccaaacgccggctgatcttctcc
aagaggaagccctaa

DBGET integrated database retrieval system