KEGG   Sus scrofa (pig): 100152316
Entry
100152316         CDS       T01009                                 

Gene name
PAK5
Definition
(RefSeq) serine/threonine-protein kinase PAK 5 isoform X1
  KO
K05736  p21-activated kinase 5 [EC:2.7.11.1]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04012  ErbB signaling pathway
ssc04014  Ras signaling pathway
ssc04360  Axon guidance
ssc04510  Focal adhesion
ssc04660  T cell receptor signaling pathway
ssc04810  Regulation of actin cytoskeleton
ssc05170  Human immunodeficiency virus 1 infection
ssc05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100152316 (PAK5)
   04014 Ras signaling pathway
    100152316 (PAK5)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100152316 (PAK5)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100152316 (PAK5)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    100152316 (PAK5)
  09158 Development and regeneration
   04360 Axon guidance
    100152316 (PAK5)
 09160 Human Diseases
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    100152316 (PAK5)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100152316 (PAK5)
Enzymes [BR:ssc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100152316 (PAK5)
Protein kinases [BR:ssc01001]
 Serine/threonine kinases: STE group
  STE20 family
   100152316 (PAK5)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PBD Kinase-like Pkinase_fungal
Other DBs
NCBI-GeneID: 100152316
NCBI-ProteinID: XP_020933063
Ensembl: ENSSSCG00000007061
LinkDB
Position
17
AA seq 744 aa
MFGKKKKKIEISGPSNFEHRVHTGFDPQEQKFTGLPQQWHSLLADTANRPKPMVDPSCIT
PIQLAPMKTIVRGNKPCKETSINGLLEDFDNISVTRSNSLRKESPPTPDQGASSHGPGHR
EENGFITFSQYSSESDTTADYATDKYRDKSLYGDDLDPFYKGGHSAKQNGHVMKMKPGEA
YYSEMKPLKSEITRFPIDYHAPLDSLSKPTEYSDLKWGYQRASSSSPLDYPFQFMPSRTA
GTSGCSKESLAYSESEWGPSLEDYDRRPKSSYLSQTSPQPAMRQRSRSGSGLQEPTMPFG
ASAFKTHSQGHSYSSYTYPRLSEPTMCIPKVDYDRAQMVLSPPLSGSDTYPRGPAKLPQS
QSKAGYSSSSHQYPSGYHKATLYHHPSLQTSSQYISTASYLSSLSFSSNTYPPPSWGSSS
DQQPSRVSHEQFRAALQLVVSPGDPREYLDNFIKIGEGSTGIVCIATEKHTGKQVAVKKM
DLRKQQRRELLFNEVVIMRDYHHDNVVDMYNSYLVSDELWVVMEFLEGGALTDIVTHTRM
NEEQIATVCLSVLKALSYLHNQGVIHRDIKSDSILLTSDGRIKLSDFGFCAQVSKEVPKR
KSLVGTPYWMAPEVISRLPYGTEVDIWSLGIMVIEMIDGEPPYFNEPPLQAMRRIRDSLP
PRGKDLHKVSSMLRGFLDLMLVREPSQRATAQELLGHPFLKLAALHPANQKELSTVTIHP
RHMQENQRLFRNFEYRTTLSHRQL
NT seq 2235 nt   +upstreamnt  +downstreamnt
atgtttggaaagaaaaagaaaaagattgaaatatccggcccatccaactttgaacacagg
gttcatactgggtttgatccgcaagaacagaaattcactggcctcccccaacagtggcac
agcctgttagcggacacagccaacaggcccaagcccatggtagacccttcgtgcatcaca
cccatccagctggctcccatgaagacaattgtcagaggaaacaaaccctgcaaggagacc
tccatcaacgggctgctagaggatttcgacaacatctcggtgactcgctccaactcccta
aggaaggaaagcccgcccaccccggaccagggagcctccagccatggtccaggccatcgg
gaagaaaacggcttcatcaccttctcacagtattccagcgaatctgacaccaccgctgac
tatgccaccgacaagtacagagacaaaagtctctatggagacgatttggatccgttttat
aagggcggccactcggccaagcaaaatgggcacgtcatgaaaatgaaacctggggaggcc
tactattctgaaatgaagcctttgaaatccgagataaccagatttcctatcgactaccac
gcacccttggactcactgagcaaaccaactgagtacagtgaccttaagtgggggtaccag
agagcctccagcagctcccctctggattatccattccagttcatgccttccagaactgca
gggaccagtgggtgctccaaggagagcctggcgtacagcgaaagtgaatggggacccagc
ctggaggactatgacaggaggccaaagtcatcatacctgagtcagacgagtcctcagccc
gccatgcggcagaggtcacggtccggctcagggctccaggaacccacgatgcccttcgga
gctagtgcttttaaaacccactcccaaggacactcctacagttcctacacctaccctcgc
ttgtctgagcccactatgtgcatcccaaaggtggattacgatcgagcacagatggtcctc
agccctccactgtcagggtccgacacctaccccaggggtcccgccaaactacctcagagt
caaagcaaagcaggctattcctcaagcagccaccagtacccatctgggtaccacaaagcc
accctgtaccaccacccctccctgcagaccagttcgcagtacatctccacagcttcttac
ctgagctctctcagcttctcatccaacacctaccccccacccagctggggctcctcctca
gaccagcagccctccagggtatcccacgaacagttccgggctgccctgcagctggtggtc
agcccaggagaccccagggaatacttggacaactttatcaaaatcggggaaggctcaacc
ggcattgtgtgcatcgccactgagaaacacacggggaagcaagtcgcggtgaagaaaatg
gacctccgaaagcaacagagacgagagctgctatttaatgaggttgtgataatgcgggat
tatcaccatgacaacgtggttgacatgtacaacagctaccttgtcagtgatgagctctgg
gtggtcatggaatttttagaaggcggtgccttgacagacatcgttactcataccagaatg
aatgaggaacagatagccactgtctgtctctcagtcctgaaagctctctcctaccttcac
aaccaaggagtgatccacagggacataaagagtgactccatcctcctgacaagtgatggc
cggataaagttgtctgactttggtttctgtgctcaagtttccaaagaggtgcccaagagg
aaatcattggttggcacgccctactggatggcacctgaggtgatttctagactgccttat
gggacagaggtggacatctggtcccttgggatcatggtgatagagatgattgacggcgag
cccccctacttcaacgagcctcccctccaggccatgcggcggatccgggacagtttacct
ccaagagggaaggacctgcacaaggtttcttccatgctccgaggattcctggacctgatg
ctggtgagggaaccctctcaaagagccacagcgcaggaactccttggacatccattcttg
aagctggcagcccttcatccagcaaatcagaaggaactcagtactgtcacgatacatcct
cgccacatgcaggagaaccaacgactctttaggaactttgaataccgaacgactctcagt
caccgtcagctttag

KEGG   Sus scrofa (pig): 100153981
Entry
100153981         CDS       T01009                                 

Gene name
PAK6
Definition
(RefSeq) serine/threonine-protein kinase PAK 6
  KO
K05735  p21-activated kinase 6 [EC:2.7.11.1]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04012  ErbB signaling pathway
ssc04014  Ras signaling pathway
ssc04360  Axon guidance
ssc04510  Focal adhesion
ssc04660  T cell receptor signaling pathway
ssc04810  Regulation of actin cytoskeleton
ssc05170  Human immunodeficiency virus 1 infection
ssc05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100153981 (PAK6)
   04014 Ras signaling pathway
    100153981 (PAK6)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100153981 (PAK6)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100153981 (PAK6)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    100153981 (PAK6)
  09158 Development and regeneration
   04360 Axon guidance
    100153981 (PAK6)
 09160 Human Diseases
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    100153981 (PAK6)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100153981 (PAK6)
Enzymes [BR:ssc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100153981 (PAK6)
Protein kinases [BR:ssc01001]
 Serine/threonine kinases: STE group
  STE20 family
   100153981 (PAK6)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PBD Kinase-like Pkinase_fungal Kdo
Other DBs
NCBI-GeneID: 100153981
NCBI-ProteinID: XP_020953445
LinkDB
Position
1
AA seq 682 aa
MFRKKKKKRPEISAPQNFQHRVHTSFDPKEGKFVGLPPQWQNILDTLRRPKPVVDPSRIT
RVQLQPMKTVVRGSSVPTDGYISGLLNDIQKLSVISSNTLRGRSPTSRRRAQSLGLLGDE
QWANDPDMYLQSPQSERTDPHGLYLSCNGGAPAGCRQTTPWPEPQSPRVLPNGLATKAQS
LGPAEFQGATQRCLQLGACLQSSPPGTSSPTATGRRGTKTARHGSEETRPQSCLVGSAAG
RPGGEGSPSPKTQESSLKRRLFRSMFLSASATAPPSSSRPGPPPQSKPTSSFRPPQKECP
PSLVAKAQSLPSDQPVGIFSPLTTSDTSSPHKSLRIAPAAGPPPGRSSPAGSPRTRHAQI
STSNLYLPQDPTVAKGALAGEDTGVVTHEQFKAALRMVVDQGDPRLLLDSYVKIGEGSTG
IVCLAREKHSGRQVAVKMMDLRKQQRRELLFNEVVIMRDYQHLNVVEMYKSYLVGEELWV
LMEFLQGGALTDIVSQVRLNEEQIATVCEAVLQALAYLHAQGVIHRDIKSDSILLTLDGR
VKLSDFGFCAQISKDVPKRKSLVGTPYWMAPEVISRSLYATEVDIWSLGIMVIEMVDGEP
PYFSDSPVQAMKRLRDSPPPKLKNSHKVSPVLRDFLERMLVRDPQERATAQELLDHPFLL
QTGLPECLVPLIQLYRKQTSTC
NT seq 2049 nt   +upstreamnt  +downstreamnt
atgttccgcaagaaaaaaaagaaacgccctgagatctcggccccacagaacttccagcac
cgtgtccacacctccttcgaccccaaagaaggcaaattcgtgggcctccccccacaatgg
cagaacatcctggacacactgagacgacccaagcctgtggtggacccttcacgcatcact
cgggtgcagctccagcccatgaagacggtggtgcggggcagctcggtgcccacggacggc
tacatctccgggctgctcaatgatatccagaagttgtcggtcatcagctccaataccttg
cgaggccgcagccccaccagccggcggcgggcacagtccctggggctgctgggggatgag
caatgggccaacgacccagacatgtacctgcagagcccccagtctgagcgcaccgacccc
cacggcctctacctcagctgcaacggaggtgcaccagcaggctgcaggcagacaacgccg
tggcctgagccgcagagcccacgggtcctgcccaatgggctggccaccaaggcacagtcc
ctgggccccgccgagttccagggtgccacgcagcgctgcctgcagttgggcgcctgcctg
cagagctccccacctggcacctcgtcccccacagccacgggcaggcgtgggaccaagact
gccaggcatggctccgaggagacccggccacagtcctgcttggtgggctcagccgcaggc
aggccgggtggggagggcagccccagccctaagacccaggagagcagcctgaagcgcagg
ctgttccgaagcatgttcctgtctgcctctgccaccgcccctccgagcagcagcaggcca
ggccctccaccacagagcaagcccacctcctctttcagaccaccacagaaagaatgcccc
ccaagcctggtggccaaggcccagtccttgccctcggaccaacctgtgggaatcttcagc
cctctgaccacctcggataccagcagcccccacaagtccctccgaatagcgccagctgcc
ggccctcctccaggccggtcttccccggcaggctccccccgcacccggcatgcccagatc
agcaccagcaacctgtacctgccccaggaccccacggtggccaagggtgccctggctggt
gaggacacgggtgttgtgacgcatgagcagttcaaggctgcactcaggatggtggtggac
cagggtgacccccggctgctgctggacagctacgtgaagattggcgagggctccacaggc
attgtctgcctggcccgggagaagcattcgggccgccaggtggccgtcaagatgatggac
ctcaggaagcagcagcgcagggagctgctctttaatgaggtggtgatcatgcgggactac
cagcacctcaacgtggtggagatgtataagagctacctggtgggtgaggagctgtgggtg
ctcatggagttcctgcagggcggggccctcacagacatcgtctctcaagtcaggctgaat
gaggagcagatcgctacggtgtgcgaggccgtgctgcaggccctggcttacctgcacgcc
cagggtgtcatccaccgggacatcaagagtgactccatcctgctgaccctcgacggcagg
gtgaaactctcagactttggattctgtgcgcaaatcagcaaagatgtccctaagaggaag
tccctggtgggaaccccctactggatggctcctgaagttatctccaggtctctgtatgcg
acggaggtggatatctggtctctgggcatcatggtgattgagatggtggatggagaacca
ccctacttcagtgactccccagtgcaagccatgaagaggctccgggacagtcccccaccc
aagctgaagaactcacacaaggtctcccctgtgctgcgagacttcctagaacggatgctg
gtgcgggacccccaggagagagccacagcccaggagctcctggaccaccccttcctgctg
cagacaggactgcctgagtgcctggtgcccctgatccagctctaccgcaagcagacctcc
acctgctga

KEGG   Sus scrofa (pig): 100511837
Entry
100511837         CDS       T01009                                 

Gene name
PAK2
Definition
(RefSeq) serine/threonine-protein kinase PAK 2
  KO
K04410  p21-activated kinase 2 [EC:2.7.11.1]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04010  MAPK signaling pathway
ssc04012  ErbB signaling pathway
ssc04014  Ras signaling pathway
ssc04360  Axon guidance
ssc04510  Focal adhesion
ssc04660  T cell receptor signaling pathway
ssc04810  Regulation of actin cytoskeleton
ssc05170  Human immunodeficiency virus 1 infection
ssc05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100511837 (PAK2)
   04012 ErbB signaling pathway
    100511837 (PAK2)
   04014 Ras signaling pathway
    100511837 (PAK2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100511837 (PAK2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100511837 (PAK2)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    100511837 (PAK2)
  09158 Development and regeneration
   04360 Axon guidance
    100511837 (PAK2)
 09160 Human Diseases
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    100511837 (PAK2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100511837 (PAK2)
Enzymes [BR:ssc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100511837 (PAK2)
Protein kinases [BR:ssc01001]
 Serine/threonine kinases: STE group
  STE20 family
   100511837 (PAK2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PBD Kinase-like Pkinase_fungal APH Kdo zinc-ribbons_6
Other DBs
NCBI-GeneID: 100511837
NCBI-ProteinID: XP_020925795
Ensembl: ENSSSCG00000011843
LinkDB
Position
13
AA seq 524 aa
MSDNGELEDKPPAPPVRMSSTIFSTGGKDPLSANHSLKPLPSVPEEKKPRNKIISIFSST
EKGSKKKEKERPEISPPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKLEQKKNP
QAVLDVLKFYDSNTVKQKYLSFTPPEKDGFPSGTPALHTKGSETSAVVTEEDDDDEETAP
PVIAPRPDHTKSIYTRSVIDPIPAPVGDSNVDGGAKTSDKQKKKAKMTDEEIMEKLRTIV
SIGDPKKKYTRYEKIGQGASGTVFTATDVALGQEVAIKQINLQKQPKKELIINEILVMKE
LKNPNIVNFLDSYLVGDELFVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQALEFLH
ANQVIHRDIKSDNVLLGMEGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAY
GPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPEKLTPIFRDFLNRC
LEMDVEKRGSARELLQHPFLKLAKPLSSLTPLIMAAKEAMKSNR
NT seq 1575 nt   +upstreamnt  +downstreamnt
atgtctgataacggagaactggaagacaagcctccagcaccccctgtgcgaatgagcagt
accatttttagtactggaggcaaagaccctttgtcagccaatcacagtttgaaacctttg
ccctctgttccagaggaaaaaaagcccaggaataaaatcatctctatattctcaagcaca
gagaaaggaagtaagaagaaagagaaggaaaggccagaaatttctcctccgtctgatttt
gagcacaccatccatgttggttttgatgctgtcactggagaattcactggcatgccagaa
cagtgggctcgattattacagacctccaatatcaccaaactagagcaaaagaagaatcct
caggctgtgctggatgtcttaaagttctacgactccaacacagtgaagcagaaatacctg
agctttactcctcctgagaaagatggcttcccttctggaacaccagcactgcataccaag
ggatcggaaacgtcagcagtagtaacagaggaagacgatgatgatgaagagactgctcct
cctgttattgccccacgaccagatcatacaaaatcaatttatacacggtctgtaattgat
cctattcctgctccagttggtgattctaatgttgatggtggtgccaagacttcagacaaa
cagaaaaagaaggccaaaatgacagatgaagagattatggagaaattaagaactattgta
agcataggtgatcctaagaaaaaatatacaagatatgaaaaaattgggcaaggggcttct
ggcacggttttcactgctactgatgtggcactgggacaagaggttgctatcaaacagatt
aatttacagaaacagccaaagaaggaattgatcattaatgagattctggtgatgaaagaa
ttaaagaatcccaacatagttaacttcttggacagttacctggtaggagatgagttgttt
gtggtaatggagtaccttgctgggggatcacttacggatgttgtaacagagacctgcatg
gatgaagcacagattgctgctgtatgcagagaatgtttacaggcattggagtttttacat
gctaaccaagtgattcacagagacatcaaaagtgacaatgtgcttttaggcatggaagga
tcggttaaacttactgactttggtttctgtgcccagatcacccctgagcagagcaagcga
agtactatggttggaacgccatactggatggcaccagaggtggttacacggaaagcttat
ggccctaaagtagacatatggtctctgggtattatggccattgagatggtagaaggagag
cctccatacctcaatgaaaatcctttgagggccttgtacctgatagcaactaatggaacc
ccagaacttcagaatccagagaaacttaccccaatatttcgagatttcttaaatcgatgt
ttggagatggatgtagagaaaaggggttcagccagagaattgttacagcatccctttctg
aaattggccaaaccattatccagcttgacaccactgatcatggcagctaaagaagcaatg
aagagtaaccgttaa

KEGG   Sus scrofa (pig): 100525766
Entry
100525766         CDS       T01009                                 

Gene name
PAK1
Definition
(RefSeq) serine/threonine-protein kinase PAK 1
  KO
K04409  p21-activated kinase 1 [EC:2.7.11.1]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04010  MAPK signaling pathway
ssc04012  ErbB signaling pathway
ssc04014  Ras signaling pathway
ssc04024  cAMP signaling pathway
ssc04062  Chemokine signaling pathway
ssc04360  Axon guidance
ssc04392  Hippo signaling pathway - multiple species
ssc04510  Focal adhesion
ssc04625  C-type lectin receptor signaling pathway
ssc04650  Natural killer cell mediated cytotoxicity
ssc04660  T cell receptor signaling pathway
ssc04666  Fc gamma R-mediated phagocytosis
ssc04810  Regulation of actin cytoskeleton
ssc05132  Salmonella infection
ssc05170  Human immunodeficiency virus 1 infection
ssc05205  Proteoglycans in cancer
ssc05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100525766 (PAK1)
   04012 ErbB signaling pathway
    100525766 (PAK1)
   04014 Ras signaling pathway
    100525766 (PAK1)
   04392 Hippo signaling pathway - multiple species
    100525766 (PAK1)
   04024 cAMP signaling pathway
    100525766 (PAK1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100525766 (PAK1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100525766 (PAK1)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100525766 (PAK1)
   04650 Natural killer cell mediated cytotoxicity
    100525766 (PAK1)
   04660 T cell receptor signaling pathway
    100525766 (PAK1)
   04666 Fc gamma R-mediated phagocytosis
    100525766 (PAK1)
   04062 Chemokine signaling pathway
    100525766 (PAK1)
  09158 Development and regeneration
   04360 Axon guidance
    100525766 (PAK1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100525766 (PAK1)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    100525766 (PAK1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100525766 (PAK1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100525766 (PAK1)
Enzymes [BR:ssc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100525766 (PAK1)
Protein kinases [BR:ssc01001]
 Serine/threonine kinases: STE group
  STE20 family
   100525766 (PAK1)
Membrane trafficking [BR:ssc04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    100525766 (PAK1)
 Endocytosis
  Macropinocytosis
   Kinases
    100525766 (PAK1)
Chromosome and associated proteins [BR:ssc03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     100525766 (PAK1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PBD Kinase-like Pkinase_fungal APH DSHCT Kdo YrbL-PhoP_reg
Other DBs
NCBI-GeneID: 100525766
NCBI-ProteinID: XP_005667221
Ensembl: ENSSSCG00000014878
Vega: OTTSUSG00000000948
UniProt: A0A480LCM5 A0A4X1UCQ5
LinkDB
Position
9
AA seq 446 aa
MPEQWARLLQTSNITKSEQKKNPQAVLDVLEFYNSKKTSNSQKYMSFTDKSAEDYNSSNT
LNVKTVSETPAVPPVSEDEDDDDDATPPPVIAPRPEHTKSVYTRSVIEPLPITPTRDVAT
SPISPTESTTTPPDALTRNTEKQKKKPKMSDEEILEKLRSIVSVGDPKKKYTRFEKIGQG
ASGTVYTAMDVATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDE
LWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGM
DGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIE
GEPPYLNENPLRALYLIATNGTPELQNPEKLSAIFRDFLNRCLEMDVEKRGSAKELLQHQ
FLKIAKPLSSLTPLIAAAKEATKNNH
NT seq 1341 nt   +upstreamnt  +downstreamnt
atgccagagcagtgggcccgcttgcttcagacgtcaaacatcaccaagtcggagcagaag
aaaaacccgcaggctgttctggatgtactggaattttataactcgaagaagacctccaac
agccagaagtacatgagctttacagataaatcagctgaggattataattcttctaacact
ttgaatgtgaagacggtgtccgagactcctgccgtgccacccgtttcagaagatgaagat
gatgatgatgatgccaccccacctccagtgattgctccacgtccggagcacacgaaatct
gtatacacacggtctgtgattgaaccacttcctattactccaactcgggatgtggctaca
tctcccatttcacctactgagagcactaccactccaccggatgccctgactcggaatact
gagaagcagaagaagaagcccaaaatgtctgatgaggagatcttggagaaattacggagc
atagtgagtgtgggtgatcctaagaagaaatacacacgatttgagaagattggacaaggt
gcttcgggcactgtgtacactgcaatggatgtggccacaggacaggaggtggccattaag
cagatgaatcttcagcagcagccgaagaaagagctgattattaatgagatcctagtcatg
agggaaaacaagaacccaaatattgtgaactacttggacagttacctcgtgggagatgaa
ctgtgggttgtcatggaatacttggctggaggttctttgacagatgtggtgacagaaacg
tgcatggatgaaggccagattgcagctgtgtgtcgggagtgcctgcaggctttggaattt
ctgcattcaaatcaagttattcatagagacatcaagagtgacaacatcctgttgggaatg
gatggctctgtcaagctaactgattttggattctgtgcccagatcaccccagagcagagc
aaacggagcaccatggtgggaaccccatattggatggcaccagaggttgtaactcggaag
gcctatggacccaaggttgacatttggtccctgggcatcatggccattgaaatgattgaa
ggggaacccccatacctcaatgaaaaccctctgagagccttgtacctcattgccaccaat
gggaccccagagcttcagaacccagagaagctgtcagctatcttccgagactttttgaac
cgctgtcttgagatggatgtggagaagagaggttcagctaaagagctgctacagcatcag
ttcctgaagattgcaaagcccctctccagcctcactccactgattgctgcagcaaaggag
gcaaccaagaacaatcactaa

KEGG   Sus scrofa (pig): 100624533
Entry
100624533         CDS       T01009                                 

Gene name
PAK3
Definition
(RefSeq) serine/threonine-protein kinase PAK 3 isoform X1
  KO
K05733  p21-activated kinase 3 [EC:2.7.11.1]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04012  ErbB signaling pathway
ssc04014  Ras signaling pathway
ssc04360  Axon guidance
ssc04510  Focal adhesion
ssc04660  T cell receptor signaling pathway
ssc04810  Regulation of actin cytoskeleton
ssc05132  Salmonella infection
ssc05170  Human immunodeficiency virus 1 infection
ssc05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100624533 (PAK3)
   04014 Ras signaling pathway
    100624533 (PAK3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100624533 (PAK3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100624533 (PAK3)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    100624533 (PAK3)
  09158 Development and regeneration
   04360 Axon guidance
    100624533 (PAK3)
 09160 Human Diseases
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    100624533 (PAK3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100624533 (PAK3)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100624533 (PAK3)
Enzymes [BR:ssc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100624533 (PAK3)
Protein kinases [BR:ssc01001]
 Serine/threonine kinases: STE group
  STE20 family
   100624533 (PAK3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PBD Pkinase_fungal Kinase-like Spt5_N DSHCT APH Kdo
Other DBs
NCBI-GeneID: 100624533
NCBI-ProteinID: XP_020936334
Ensembl: ENSSSCG00000022821 ENSSSCG00000025306
LinkDB
Position
X
AA seq 559 aa
MSDGLDNEEKPPAPPLRMNSNNRDSSALNHSSKPLPMAPEEKNKKARLRSIFPGGGDKTN
KKKEKERPEISLPSDFEHTIHVGFDAVTGEFTPDLYGSQMCPGKLPEGIPEQWARLLQTS
NITKLEQKKNPQAVLDVLKFYDSKETVNNQKYMSFTSGDKSAHGYIAAHPSSTKTASEPP
LAPPVSEEEDEEEEEEEDENEPPPVIAPRPEHTKSIYTRSVVESIASPAAPNKEVTPPSA
ENANSSTLYRNTDRQRKKSKMTDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTA
LDIATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYL
AGGSLTDVVTETCMDEGQIAAVCRECLQALDFLHSNQVIHRDIKSDNILLGMDGSVKLTD
FGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNE
NPLRALYLIATNGTPELQNPERLSAVFRDFLNRCLEMDVDRRGSAKELLQHPFLKLAKPL
SSLTPLIIAAKEAIKNSSR
NT seq 1680 nt   +upstreamnt  +downstreamnt
atgtctgacggtctggataatgaagagaagcccccagctcccccactgaggatgaacagt
aacaaccgggactcttcggcactcaaccacagctccaaaccacttcccatggcccccgaa
gagaagaataagaaagccaggctccgctctatcttcccaggaggaggggataaaaccaat
aagaagaaagagaaagaacgcccagagatctctcttccttcagactttgaacatacgatt
catgtggggtttgatgcagtcaccggggaattcactccagatctctatggctcacagatg
tgcccagggaagctcccagagggaattcctgagcaatgggcacgattactccaaacctcc
aacataacaaagctggaacagaagaagaacccacaggccgttctcgatgttctcaaattc
tatgattccaaagaaacagtcaacaaccagaaatacatgagctttacatcaggagataaa
agcgcacatggatacatagcagcccatccttcgagtacaaaaacagcgtcagagcctcct
ttggctccccctgtgtctgaggaagaagatgaagaagaggaagaagaagaagacgagaat
gagcctccaccagttattgcgccaagaccagagcatacaaaatcaatctatactcgttcc
gtggttgaatccattgcttcaccagcagcaccaaataaagaggtcacaccaccttctgct
gagaatgccaattccagtactttgtatagaaacacagatcggcaaaggaaaaaatccaag
atgacagatgaggagatcctagagaagctaagaagcattgtgagtgttggtgacccaaag
aaaaaatacacaagatttgaaaaaataggtcaaggggcatcgggtactgtttacacagcg
ctggacattgccacgggacaagaggtggccataaagcagatgaaccttcaacagcagccc
aaaaaggaattaattattaatgaaattctggtcatgagggaaaataagaacccaaatatt
gttaattatttagatagctacttagtgggtgatgaactatgggtagtcatggaatacttg
gccggtggctctttgactgatgtggtcacggagacctgtatggatgaaggacagatagca
gctgtctgcagagagtgcctccaagctttggatttcttgcactcaaaccaagtgatccac
agagacataaagagtgacaatattctccttgggatggatggctctgttaaattgactgat
tttgggttctgcgcccagatcacccctgagcaaagtaaacgaagcactatggtgggaacg
ccttactggatggctcctgaggtggtgactcgaaaagcttatggtccgaaagttgatatc
tggtctctggggattatggcaatcgaaatggtagaaggtgaacccccttaccttaatgaa
aatccactcagggcattatatctgatagccactaatggaacccccgagctccagaatccc
gagagactgtctgctgtgttccgtgattttttaaatcgctgtcttgagatggatgtggac
agacgaggatccgccaaggagcttttgcagcatccatttttaaaattagccaagcctctc
tccagcctgactcctctgattattgctgcaaaggaagcgattaagaacagcagccgctag

KEGG   Sus scrofa (pig): 100627936
Entry
100627936         CDS       T01009                                 

Gene name
PAK4
Definition
(RefSeq) serine/threonine-protein kinase PAK 4
  KO
K05734  p21-activated kinase 4 [EC:2.7.11.1]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04012  ErbB signaling pathway
ssc04014  Ras signaling pathway
ssc04360  Axon guidance
ssc04510  Focal adhesion
ssc04660  T cell receptor signaling pathway
ssc04810  Regulation of actin cytoskeleton
ssc05170  Human immunodeficiency virus 1 infection
ssc05206  MicroRNAs in cancer
ssc05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100627936 (PAK4)
   04014 Ras signaling pathway
    100627936 (PAK4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100627936 (PAK4)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100627936 (PAK4)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    100627936 (PAK4)
  09158 Development and regeneration
   04360 Axon guidance
    100627936 (PAK4)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100627936 (PAK4)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    100627936 (PAK4)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100627936 (PAK4)
Enzymes [BR:ssc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100627936 (PAK4)
Protein kinases [BR:ssc01001]
 Serine/threonine kinases: STE group
  STE20 family
   100627936 (PAK4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PBD Kinase-like Pkinase_fungal Kdo KIND hnRNP_Q_AcD
Other DBs
NCBI-GeneID: 100627936
NCBI-ProteinID: XP_003355937
Ensembl: ENSSSCG00000030520
UniProt: A0A480YBA9
LinkDB
Position
6
AA seq 591 aa
MFGKKKKRVEISAPSNFEHRVHTGFDQNEQKFTGLPRQWQSLIEESARRPKPLVDPACIT
SIQPGAPKTIVRGSKGAKDGALTLLLDEFENMSVTRSNSLRRDSPPPPARARQENGMPAE
QAAMARGGPEKAGGQGRVAGRSETGGNSGDRRRAGPDKRLKSSREGSGGPQESSRDKRPL
SGPDVGTPDQPAGLASGAKVAAGRPFNTYPRADTDHPPRGAQGEPHNVAPNGPSVGGLAV
PQSSRPPARARGTPSPGVLGPHASEPQLAPPARTPAAPAAPPAPGPPGPRSPQREPQRVS
HEQFRAALQLVVDPGDPRSYLDNFIKIGEGSTGIVCIATVRSSGRLVAVKKMDLRKQQRR
ELLFNEVVIMRDYQHENVVEMYNSYLVGDELWVVMEFLEGGALTDIVTHTRMNEEQIAAV
CLAVLQALSVLHAQGVIHRDIKSDSILLTHDGRVKLSDFGFCAQVSKEVPRRKSLVGTPY
WMAPELISRLPYGPEVDIWSLGVMVIEMVDGEPPYFNEPPLKAMKMIRDNLPPRLKNLHK
VSPSLKGFLDRLLVRDPAQRATAAELLKHPFLAKAGPPASIVPLMRQNRTR
NT seq 1776 nt   +upstreamnt  +downstreamnt
atgttcgggaagaagaagaagcgggttgagatctcagcgccgtcgaactttgaacaccgt
gtgcacacgggcttcgaccagaacgagcagaagttcacggggctgccccgccagtggcag
agcctgatcgaggagtcggctcgccggcccaagccccttgttgaccccgcctgcatcacc
tccatccagcccggggcccccaagaccatcgtgcggggcagcaaaggtgccaaggatggg
gccctcacgctgctgctcgacgaatttgagaacatgtcggtgacacgctccaactccctg
cggagagacagcccgccgccacctgcccgtgcccgccaggaaaacgggatgcccgcggag
caggccgccatggccagagggggcccagagaaggcgggtggccaaggccgggtggccggt
cgcagcgagacgggtggcaacagtggtgacaggcggcgggcggggccggacaagaggctc
aagtcttccagggagggctcagggggcccccaggagtcctcccgggacaagcgccccctc
tcagggcctgacgtcggcacccccgaccagcctgccgggctggccagcggggcgaaagtg
gcggctggccggccctttaacacgtacccgcgggctgacacggaccacccaccccggggc
gcccagggggagcctcacaacgtggcccccaatgggccatcggtggggggcctggctgtc
ccgcagtcctcccggccccccgctcgagcccgcggcacccccagcccaggcgtgctgggc
ccccacgcctccgagccccagctggcccctccagcccgcaccccagccgcccctgccgca
ccccctgcccctgggccccctggccctcgatcgccacagcgggaaccccagcgagtgtcc
catgagcagttccgggccgccctgcagctggtggtggaccccggcgacccgcgctcctac
ctggacaacttcatcaagatcggcgagggctccacaggcatcgtgtgcatcgccaccgtg
cgcagctcgggcaggctggtggctgtcaagaagatggacctgcgcaagcagcagaggcgc
gagctgctcttcaatgaggtggtgatcatgcgggactaccagcacgagaacgtggtggag
atgtacaacagctacctggtcggcgacgagctctgggtggtgatggagttcctggaggga
ggcgccctcaccgacattgtcacccacaccaggatgaacgaggagcagatcgccgccgtg
tgcctggccgtgctgcaggccttgtccgtcctccacgcccagggcgtcatccaccgcgac
atcaagagcgactccatcctgctgacccatgatggccgggtgaagctgtcggactttggg
ttctgcgcccaggtgagcaaggaggtgccgcggaggaagtccctggtgggcacgccctac
tggatggccccggagctcatctcccgccttccctacgggccagaggtggacatctggtct
ctgggggtgatggtgatcgagatggtggacggggagcccccctacttcaacgagccaccc
ctcaaagccatgaagatgattcgggacaacctgccgccccgactgaagaatctgcacaag
gtgtcaccctccctgaagggcttcctggaccgcctgctggtgcgtgacccggcacagcgg
gccacggcggctgagctgctcaagcacccgttcctggccaaagcaggcccgcctgccagt
atcgtgcccctcatgcgccagaaccgcaccagatga

DBGET integrated database retrieval system