KEGG   Sus scrofa (pig): 100152344Help
Entry
100152344         CDS       T01009                                 

Gene name
HK1
Definition
(RefSeq) hexokinase-1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc00010  Glycolysis / Gluconeogenesis
ssc00051  Fructose and mannose metabolism
ssc00052  Galactose metabolism
ssc00500  Starch and sucrose metabolism
ssc00520  Amino sugar and nucleotide sugar metabolism
ssc00524  Neomycin, kanamycin and gentamicin biosynthesis
ssc01100  Metabolic pathways
ssc01200  Carbon metabolism
ssc04066  HIF-1 signaling pathway
ssc04910  Insulin signaling pathway
ssc04930  Type II diabetes mellitus
ssc04973  Carbohydrate digestion and absorption
ssc05230  Central carbon metabolism in cancer
Module
ssc_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ssc_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100152344 (HK1)
   00051 Fructose and mannose metabolism
    100152344 (HK1)
   00052 Galactose metabolism
    100152344 (HK1)
   00500 Starch and sucrose metabolism
    100152344 (HK1)
   00520 Amino sugar and nucleotide sugar metabolism
    100152344 (HK1)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    100152344 (HK1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    100152344 (HK1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100152344 (HK1)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100152344 (HK1)
 09160 Human Diseases
  09161 Cancers
   05230 Central carbon metabolism in cancer
    100152344 (HK1)
  09166 Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    100152344 (HK1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ssc04131]
    100152344 (HK1)
Enzymes [BR:ssc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     100152344 (HK1)
Membrane trafficking [BR:ssc04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    100152344 (HK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 CSD
Motif
Other DBs
NCBI-GeneID: 100152344
NCBI-ProteinID: NP_001230113
Ensembl: ENSSSCG00000010253
LinkDB All DBs
Position
14
AA seq 916 aa AA seqDB search
MIAAQLLAYYFTELKDDQIKKIDKYLYAMRLSDETLLDIMARFKKEMKNGLSRDFNPTAI
VKMLPTFVRSIPDGSEKGDFIALDLGGSSFRILRVQVNHEQNQNVLMESEIYDTPESIMH
GSGSQLFDHVAECLGDFMEKKKIKDKKLPVGFTFSFPCRQSKIDEAILITWTKRFKASGV
EGTDVVKLLEKAIKKRGDYDANIVAVVNDTVGTMMTCGYDDQQCEVGLIIGTGTNACYME
ELRHIDLVEGDEGRMCINTEWGAFGDDGALEDIRTEFDREIDRGSLNPGKQLFEKMVSGM
YMGELVRLILVKMAKEGLLFEGRITPELLTRGKFNTSDVSAIEKNKEGLHNAKEILTRLG
VEPSDDDCISVQHVCTIVSFRSANLVAATLGAILNRLRDNKSTPRLRTTVGVDGSLYKTH
PQYSRRFHKTLRRLVPDCDVRFLLSESGSGKGAAMVTAVAYRLAEQHRQIQETLAHFSLT
KDMLLEVKRRMRAEMDLGLKKETHDKAVVKMLPSFVRSTPDGTEHGDFLALDLGGTNFRV
LLVKIRSGKKRSVEMHNKIYAIPIEIMQGTGEELFDHIVSCISDFLDYMGIKGPRMPLGF
TFSFPCKQTNLDVGILITWTKGFKATDCVGHDVVTLLRDAIKRREEFDLDVVAVVNDTVG
TMMTCAYEEPTCEVGLIVGTGSNACYMEEMKNVEMLEGTEGRMCINMEWGAFGDNGCLDD
IRTIYDKMVDEYSLNAGKQRYEKMISGMYLGVIVRNILIDFTKRGFLFRGQISEPLKTRG
IFQTKYLSQIESDRLALLQVRAILQQLGLNSTCDDSILVKTVCGVVSKRAAQLCGAGMAA
VVDKIRENRGLDHLNVTVGVDGTLYKLHPHFSRIMHQTVKELSPKCNVSFLLSEDGSGKG
AALITAVGVRLREGSS
NT seq 2751 nt NT seq  +upstreamnt  +downstreamnt
atgatcgccgcgcagctcctggcctattacttcaccgaactgaaggatgaccaaatcaaa
aagattgacaagtatctctatgccatgcggctctctgatgaaactctgttagatatcatg
gctcgtttcaaaaaggagatgaagaatggcctctcccgggatttcaatccgacagccata
gtcaagatgttgccaacattcgtaaggtccattcctgacggttcagaaaagggagatttc
attgccttggatcttggcggttcttcctttcgaattctgcgcgtgcaagtgaatcatgag
caaaaccagaatgttcttatggagtcggagatttatgacaccccggagagcatcatgcat
ggcagtggaagccagcttttcgatcatgtcgctgagtgcctaggagacttcatggagaaa
aaaaaaattaaggacaagaaattacctgtgggatttacgttttctttcccttgtcggcaa
tccaaaatagatgaggccatcctgatcacctggacaaagagatttaaagcaagcggagtg
gagggaacagatgtggtgaagctgcttgagaaagccatcaaaaaacgcggggactatgat
gccaacattgtggctgtggtgaatgacacagtggggaccatgatgacctgtggctatgac
gaccagcagtgtgaagtcggtctcatcattggtaccggcaccaacgcgtgctacatggag
gagctgaggcacatcgacctggtggagggtgacgagggcaggatgtgcatcaacaccgag
tggggggccttcggggatgacggggccctggaggacatccgcactgaatttgaccgggag
atagaccgggggtcgctcaaccctgggaagcagctgttcgagaagatggtcagtggcatg
tacatgggtgagctggtccgacttatcctggtcaagatggccaaagagggcctcttattt
gaagggcgaatcaccccggagctgctcaccagagggaagttcaacaccagtgatgtgtca
gccatagaaaagaataaggaaggccttcacaatgccaaagaaatcctgacccgcctgggg
gtggagccatccgatgacgactgtatttcggtccagcacgtgtgcaccatcgtctccttt
cgctcggccaacctggtggctgcgacgctgggcgccatcttgaatcgccttcgagataac
aagagcacacccaggctgcggaccacggttggtgtcgacgggtctctttacaagacgcac
ccacagtactcccggcgtttccacaagactctgaggcgcttggtgcccgactgtgatgtg
cgtttcctcctctcggagagcggcagcggtaagggggccgccatggtgactgcggtggcc
taccgcctggctgagcagcaccggcagatccaggagaccctggcccacttcagtctcacc
aaggatatgctgctggaggtgaaaaggaggatgcgagccgagatggatttggggctgaag
aaggagacgcatgacaaggccgtggtcaagatgctgccctcctttgtccggagcactcct
gatgggacggagcacggtgacttcttggccctggatcttggaggaacgaacttccgcgtc
ctgctggtgaaaattcgtagtgggaaaaagagatcggtggaaatgcacaacaaaatctac
gccattcccattgaaatcatgcagggcactggggaagagctgtttgaccacatcgtttcc
tgcatctctgacttcctggactacatgggcatcaagggccccagaatgcctctgggcttc
acgttttcgtttccctgcaagcagacgaacttggatgtgggaattttgatcacctggacg
aagggttttaaggcaactgactgcgtggggcacgatgtggtgaccttactgagggatgca
ataaaaaggagagaggaattcgacctggacgtggtggctgtggtcaatgacacggtgggc
accatgatgacctgtgcttatgaggaacccacctgcgaggttggactcatcgtagggact
ggcagcaatgcctgctacatggaagaaatgaagaatgttgagatgctagaaggaactgag
gggcgaatgtgtatcaacatggagtggggtgcctttggggacaatgggtgtctggatgac
atcagaacaatctatgacaaaatggtggacgaatattctctaaacgcagggaaacaaagg
tatgagaagatgatcagtggcatgtacctgggtgtaatcgtccgcaacatcttgatcgac
ttcaccaagaggggattcctcttccgggggcagatctctgaaccgctgaagacgcggggc
atctttcagaccaagtatctctcgcagatcgagagcgaccggttagcgctgctccaggtc
cgggccatcctccagcagctgggcctgaacagcacctgcgatgacagtatcctcgtgaag
accgtgtgcggggtggtgtccaagagggcagcgcagctgtgcggtgccggcatggcggcc
gtagtggataagatccgtgagaacagagggctggaccacctcaacgtgactgtgggtgtg
gacgggacgctgtacaagcttcatccacacttctccagaatcatgcaccaaaccgtgaag
gaactgtcaccaaagtgtaacgtgtccttcctcttatccgaagacggtagtggcaaggga
gctgccctcatcacggcagtgggcgtccggctccgagaggggagcagctaa

DBGET integrated database retrieval system