KEGG   Sus scrofa (pig): 100152997Help
Entry
100152997         CDS       T01009                                 

Gene name
GADD45G
Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 gamma
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04010  MAPK signaling pathway
ssc04068  FoxO signaling pathway
ssc04110  Cell cycle
ssc04115  p53 signaling pathway
ssc04210  Apoptosis
ssc04218  Cellular senescence
ssc05169  Epstein-Barr virus infection
ssc05200  Pathways in cancer
ssc05202  Transcriptional misregulation in cancer
ssc05210  Colorectal cancer
ssc05212  Pancreatic cancer
ssc05213  Endometrial cancer
ssc05214  Glioma
ssc05216  Thyroid cancer
ssc05217  Basal cell carcinoma
ssc05218  Melanoma
ssc05220  Chronic myeloid leukemia
ssc05222  Small cell lung cancer
ssc05223  Non-small cell lung cancer
ssc05224  Breast cancer
ssc05225  Hepatocellular carcinoma
ssc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100152997 (GADD45G)
   04068 FoxO signaling pathway
    100152997 (GADD45G)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100152997 (GADD45G)
   04210 Apoptosis
    100152997 (GADD45G)
   04115 p53 signaling pathway
    100152997 (GADD45G)
   04218 Cellular senescence
    100152997 (GADD45G)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100152997 (GADD45G)
   05202 Transcriptional misregulation in cancer
    100152997 (GADD45G)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100152997 (GADD45G)
   05212 Pancreatic cancer
    100152997 (GADD45G)
   05225 Hepatocellular carcinoma
    100152997 (GADD45G)
   05226 Gastric cancer
    100152997 (GADD45G)
   05214 Glioma
    100152997 (GADD45G)
   05216 Thyroid cancer
    100152997 (GADD45G)
   05220 Chronic myeloid leukemia
    100152997 (GADD45G)
   05217 Basal cell carcinoma
    100152997 (GADD45G)
   05218 Melanoma
    100152997 (GADD45G)
   05213 Endometrial cancer
    100152997 (GADD45G)
   05224 Breast cancer
    100152997 (GADD45G)
   05222 Small cell lung cancer
    100152997 (GADD45G)
   05223 Non-small cell lung cancer
    100152997 (GADD45G)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    100152997 (GADD45G)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ssc03036]
    100152997 (GADD45G)
Chromosome and associated proteins [BR:ssc03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     100152997 (GADD45G)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     100152997 (GADD45G)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribosomal_L7Ae
Motif
Other DBs
NCBI-GeneID: 100152997
NCBI-ProteinID: NP_001172058
Ensembl: ENSSSCG00000009585
Vega: OTTSUSG00000001621
UniProt: D3Y270 A0A4X1SEY5
LinkDB All DBs
Position
14
AA seq 159 aa AA seqDB search
MTLEEVRGQDTVPESTARMQGAGKALHELLLSAQRQGCLTAGVYESAKVLNVDPDNVTFC
VLAADEEDEGDIALQIHFTLIQAFCCENDIDIVRVGDVQRLAAIVGTGDEAGTPGDLHCI
LISNPNEDAWKDPALEKLSLFCEESRSVNDWVPNITLPE
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgactctggaagaagttcgcggccaggatacggttccagaaagcacggccaggatgcag
ggcgccgggaaagcactgcacgagctgttgctgtcggcgcagcgacagggctgcctcacc
gccggcgtctacgagtccgccaaagtcctgaatgtggaccccgacaacgtgaccttttgc
gtgctggctgctgacgaggaagacgagggcgacattgcgctgcagattcacttcactttg
atccaggcgttctgctgtgagaacgacatcgacatcgtgcgtgtgggcgatgtgcagcgg
ctggcggcgatcgtgggcaccggtgacgaggcgggcacgccgggagacctgcattgcatc
ctcatttcgaaccccaatgaggacgcgtggaaggaccccgccttggagaagctcagcctg
ttctgcgaggagagtcgcagcgtcaacgactgggtgcccaatatcaccctccccgagtga

DBGET integrated database retrieval system