KEGG   Sus scrofa (pig): 100153042Help
Entry
100153042         CDS       T01009                                 

Gene name
TGM3
Definition
(RefSeq) protein-glutamine gamma-glutamyltransferase E
  KO
K05620  transglutaminase 3 [EC:2.3.2.13]
Organism
ssc  Sus scrofa (pig)
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    100153042 (TGM3)
Enzymes [BR:ssc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     100153042 (TGM3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_C Transglut_N Transglut_core
Motif
Other DBs
NCBI-GeneID: 100153042
NCBI-ProteinID: XP_020933256
LinkDB All DBs
Position
17
AA seq 751 aa AA seqDB search
MTWCLAHFIRILIGVCRRGFYKWQGDPSSPSPHTIRAIPGRAQRGGRGRRNMSAFKLQSI
DWQTASNRQAHHTDRFYSKELILRRGQLFKFSLTLNQSLGSADGLTFTVSTGPSASESAK
TKAVFPLSNETRSSGWSAQLLSRRDNVLAISILSPASAPIGRYELSIRISSQGKDSTLKL
GTFILLFNPWLQADVVFMNNQAEREEYVQEDAGIIFVGSSNRIGMIGWNYGQFEEGILNI
CLSVLDNSLNFRRDPATDVARRNDPTYVGRVLSAMINGNDDSGVVSGNWSGNYAGGLDPR
NWNGSVEILKQWQRSGFRPVRYGQCWVFAGVLNTVLRCFGIPSRVITNFNSAHDTDQNLS
VDVYYDATGRPLDKGSDSVWNFHVWNEAWFVRNDLGSSYSGWQVLDATPQEESEGVFQCG
PASVIAIREGDVNLDFDLPFIFSEVNADRITWIYDASTGAQKRTSTDSHSIGRYISTKAV
GSYSRMDVTEKYKYPEGSREERQAFEKALGKLKPRLSFGPTSARTFTRDEREEREEREPS
ISGRFKVTGLLAVGKEVNLALMLKNLTDDKKTVTVNMSAWTIVYNGTLVHEVWKDSITIS
LDPKEEIQHPVKIAYAQYEKYLKADNMIRITAVCQVTDEPEVVVERNVILDNPTLTLEVL
DQARVKKPVNVQMLFANPLDEPVKDCVLKVEGSGLLLGSLRIDVPALRPKERSRVRFEIM
PTRSGTKQLLADFSCNKFPAIKSMLSIDVAE
NT seq 2256 nt NT seq  +upstreamnt  +downstreamnt
atgacctggtgcctcgcccacttcattagaattctaattggggtgtgtaggagaggcttc
tataaatggcaaggagatcccagcagcccttcaccccacaccatccgtgccattccggga
cgagcccagagaggaggcagaggaaggcgaaacatgtctgctttcaaactccagagtatc
gactggcagacggcctccaaccggcaggcacatcacacagacaggttctacagcaaggag
ctcatcttgcggagaggccagctcttcaagttctcattgaccctgaaccaaagtcttggt
tctgcagatggtctgaccttcaccgtctccacagggccttccgcctcagagtcggccaag
acgaaggctgtgtttccactctccaatgagacaagaagcagcggctggagtgcacaactt
ctgtccagaagggacaacgttctggccatctccatcctcagtccagccagtgcgcccatc
ggaaggtatgagctgagcattcggatctcctcccagggcaaggactccactctgaaactt
gggacattcatactgctcttcaacccctggttgcaagccgatgttgtctttatgaataac
caagctgagagagaggagtatgttcaggaagacgccggcatcatctttgtgggaagctca
aatcgaattggcatgattggctggaactacggacagtttgaagaaggcattctgaacatc
tgcctctcagtcctggataacagtctgaatttccgccgtgaccctgccaccgatgtggcc
cgcaggaatgaccccacatatgttggccgcgtgctgagtgccatgatcaatggcaacgat
gacagcggtgtggtttctgggaactggagcggtaactacgcgggtggcctggacccaaga
aactggaacggcagcgtggagatccttaagcagtggcagagatctggcttcaggcccgtc
cgatacggccagtgctgggtcttcgcgggggtcctcaacacagtgctgcggtgctttggg
attccttcccgagtgatcaccaacttcaactcggctcatgacacagaccaaaacctcagc
gtggacgtgtactacgacgccacgggacggcccttggacaaaggcagtgacagcgtatgg
aatttccacgtctggaatgaagcctggtttgtgcggaatgacctgggctcttcttacagt
ggatggcaggttctggatgccaccccccaggaggagagcgaaggggtgttccagtgcggt
cctgcttccgttatcgctattcgagagggtgatgtgaacttggacttcgacctgcccttc
atcttttcggaggtcaatgctgaccgcatcacctggatctacgatgcctcaactggtgcc
cagaagcggacttccacagattctcacagcatcggcaggtacattagtaccaaggcggtg
ggcagctactctcgcatggatgtcacggaaaagtacaagtacccagaaggttccagggag
gaaagacaagcatttgaaaaggctctggggaaacttaagcccaggttgtcatttggccca
acatcggcaagaactttcacaagagatgaacgagaggaacgagaggaacgggagcccagc
atctctgggaggttcaaggtcacgggcctactggccgtgggcaaagaagtcaacctggcc
ctgatgctcaaaaacctaacggatgataagaagacggtgacagtgaacatgtcagcctgg
accatcgtctacaatggcacactcgtacacgaggtgtggaaggactccatcaccatatct
ctggatcctaaagaagaaatacagcaccctgtaaagattgcatatgctcagtatgagaag
tacctgaaagcagacaacatgatccggatcacagctgtgtgccaggtcaccgacgagccc
gaggtggtggtggagagaaacgtcatcctggacaaccctaccctgaccctggaggtgctg
gaccaggcccgggtgaagaagcccgtgaatgtgcagatgctcttcgccaacccgctggat
gagccagtgaaggactgcgtgctgaaggtggagggtagcggcctgctgctgggcagcctc
aggatcgacgtgccagccctgcgccccaaggagcggtcccgagtgcgttttgagatcatg
cccacccggagcggcaccaagcagctcctcgctgacttctcctgcaacaaattccctgcg
atcaagtccatgctgtccatcgacgtggctgagtga

DBGET integrated database retrieval system