KEGG   Sus scrofa (pig): 100153078
Entry
100153078         CDS       T01009                                 

Gene name
FZD3
Definition
(RefSeq) frizzled-3 isoform X1
  KO
K02329  frizzled 3
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04150  mTOR signaling pathway
ssc04310  Wnt signaling pathway
ssc04360  Axon guidance
ssc04390  Hippo signaling pathway
ssc04550  Signaling pathways regulating pluripotency of stem cells
ssc04916  Melanogenesis
ssc04934  Cushing syndrome
ssc05010  Alzheimer disease
ssc05022  Pathways of neurodegeneration - multiple diseases
ssc05165  Human papillomavirus infection
ssc05200  Pathways in cancer
ssc05205  Proteoglycans in cancer
ssc05206  MicroRNAs in cancer
ssc05217  Basal cell carcinoma
ssc05224  Breast cancer
ssc05225  Hepatocellular carcinoma
ssc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100153078 (FZD3)
   04390 Hippo signaling pathway
    100153078 (FZD3)
   04150 mTOR signaling pathway
    100153078 (FZD3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100153078 (FZD3)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100153078 (FZD3)
  09158 Development and regeneration
   04360 Axon guidance
    100153078 (FZD3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100153078 (FZD3)
   05206 MicroRNAs in cancer
    100153078 (FZD3)
   05205 Proteoglycans in cancer
    100153078 (FZD3)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100153078 (FZD3)
   05226 Gastric cancer
    100153078 (FZD3)
   05217 Basal cell carcinoma
    100153078 (FZD3)
   05224 Breast cancer
    100153078 (FZD3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100153078 (FZD3)
   05022 Pathways of neurodegeneration - multiple diseases
    100153078 (FZD3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100153078 (FZD3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100153078 (FZD3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:ssc04030]
    100153078 (FZD3)
G protein-coupled receptors [BR:ssc04030]
 Frizzled / Smoothened family
  100153078 (FZD3)
SSDB
Motif
Pfam: Frizzled Fz
Other DBs
NCBI-GeneID: 100153078
NCBI-ProteinID: XP_001928822
Ensembl: ENSSSCG00000009679
UniProt: A0A4X1VBQ3 A0A286ZRQ0
LinkDB
Position
14
AA seq 666 aa
MAMSWIIFCLWPLTMFVGHTGGHSLFSCEPITLRMCQDLPYNTTFMPNLLNHYDQQTAAL
AMEPFHPMVNLDCSRDFRPFLCALYAPICMEYGRVTLPCRRLCQRAYSECSKLMEMFGVP
WPEDMECSRFPDCDEPYPRLVDLNLAGDPTEGAPVAVQRDYGFWCPRELKIDPDLGYSFL
HVRDCSPPCPNMYFRREELSFARYFIGLISIICLSATLFTFLTFLIDVTRFRYPERPIIF
YAVCYMMVSLIFFIGFLLEDRVACNASSPAQYKASTVTQGSHNKACTMLFMVLYFFTMAG
SVWWVILTITWFLAAVPKWGSEAIEKKALLFHASAWGIPGTLTIILLAMNKIEGDNISGV
CFVGLYDVDALRYFVLAPLCLYVVVGVSLLLAGIISLNRVRIEIPLEKENQDKLVKFMIR
IGVFSILYLVPLLVVIGCYFYEQAYRGIWETTWIQERCREYHIPCPYQVTQMSRPDLILF
LMKYLMALIVGIPSIFWVGSKKTCFEWASFFHGRRKKEIVNESRQVLQEPDFAQSLLRDP
NTPIIRKSRGTSTQGTSTHASSTQLAMVDDQRSKAGSVHSKVSSYHGSLHRSRDGRYTPC
SYRGMEERPPHGSMSRLTDHSRHSSSHRLNEQSRHSSIRDLSNNPMTHITHGTSMNRVIE
EDGTSA
NT seq 2001 nt   +upstreamnt  +downstreamnt
atggctatgagttggatcatcttctgtctgtggcccttgactatgtttgtgggacataca
ggtgggcacagtttgttttcttgtgaacctattaccttgaggatgtgccaagatttgcct
tataatactaccttcatgcctaatcttctgaatcattatgaccaacagacagcagcttta
gcaatggagccattccaccctatggtgaatctggattgttctcgggatttccggccattt
ctttgtgcactctatgctcctatttgtatggaatatggacgtgtcacacttccctgccgt
aggctatgtcagcgggcttatagtgagtgttcgaagctcatggagatgtttggtgttcct
tggcctgaagatatggaatgtagtaggttcccagattgtgatgaaccgtatcctcgactt
gtggatctgaatttagctggagatcctactgaaggagccccagtggctgtgcagagggac
tatggtttttggtgtccccgagagttaaaaattgatcctgatcttggctattcttttttg
cacgtccgtgattgttcacctccttgtccaaatatgtactttaggagagaagaactttca
tttgctcgatatttcataggattgatttcaatcatttgcctctctgccacattgtttact
tttttaacttttttgattgatgtcacaagattccgttatcctgaaagacctattatattt
tatgcagtctgctacatgatggtgtcgttaattttcttcattgggtttttgcttgaggac
cgagtagcctgcaatgcatcaagccctgcacagtataaggcttccacagtgacacaagga
tctcataataaagcctgtaccatgctttttatggtactctatttttttactatggctgga
agcgtttggtgggtaattcttaccatcacatggttcttggcggctgtgccaaagtggggt
agtgaagctattgagaagaaagcattgctgtttcacgccagcgcatggggcatccccgga
actctaactatcatccttttagcgatgaataaaattgaaggtgacaatatcagtggcgtg
tgttttgttggcctctacgatgttgatgcattgaggtatttcgttcttgcacccctctgc
ctatatgtggtagttggggtttcactcctcttagctggcatcatatcccttaacagagtt
cgaattgagattccattagaaaaggagaaccaagataaattggtgaagtttatgatccgg
attggtgttttcagcattctttatctcgtaccactcttggttgttattggatgctacttt
tatgagcaagcttaccgtggcatctgggaaacaacatggatacaagaacgttgccgagaa
tatcacattccatgtccatatcaggttactcagatgagtcgtccagacctgattcttttt
ctgatgaaatacctgatggctctcatagttggtattccgtccattttttgggttggaagc
aaaaagacatgctttgaatgggccagtttctttcatggtcgtaggaaaaaagagatagtg
aatgagagccgacaggtactacaagaacctgattttgctcagtccctcctgagggatcca
aatactcctattataagaaaatcaagaggaacttccactcaaggaacatccacacatgct
tcttcaacacagctggccatggtggatgatcagagaagcaaagcagggagtgtccacagc
aaagtgagcagctaccatggcagcctccacagatcccgtgatggcaggtatactccctgc
agttacagagggatggaggagagaccacctcatggcagcatgtcacgactgacagatcac
tccaggcacagtagttctcatcggctcaatgagcagtcacgacacagcagcatcagagat
ctcagtaataatcctatgactcacatcacacacggcaccagcatgaatcgggttatcgaa
gaagatggaaccagtgcttaa

KEGG   Sus scrofa (pig): 100157360
Entry
100157360         CDS       T01009                                 

Gene name
FZD6
Definition
(RefSeq) frizzled-6 precursor
  KO
K02376  frizzled 6
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04150  mTOR signaling pathway
ssc04310  Wnt signaling pathway
ssc04390  Hippo signaling pathway
ssc04550  Signaling pathways regulating pluripotency of stem cells
ssc04916  Melanogenesis
ssc04934  Cushing syndrome
ssc05010  Alzheimer disease
ssc05022  Pathways of neurodegeneration - multiple diseases
ssc05165  Human papillomavirus infection
ssc05200  Pathways in cancer
ssc05205  Proteoglycans in cancer
ssc05217  Basal cell carcinoma
ssc05224  Breast cancer
ssc05225  Hepatocellular carcinoma
ssc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100157360 (FZD6)
   04390 Hippo signaling pathway
    100157360 (FZD6)
   04150 mTOR signaling pathway
    100157360 (FZD6)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100157360 (FZD6)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100157360 (FZD6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100157360 (FZD6)
   05205 Proteoglycans in cancer
    100157360 (FZD6)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100157360 (FZD6)
   05226 Gastric cancer
    100157360 (FZD6)
   05217 Basal cell carcinoma
    100157360 (FZD6)
   05224 Breast cancer
    100157360 (FZD6)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100157360 (FZD6)
   05022 Pathways of neurodegeneration - multiple diseases
    100157360 (FZD6)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100157360 (FZD6)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100157360 (FZD6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:ssc04030]
    100157360 (FZD6)
G protein-coupled receptors [BR:ssc04030]
 Frizzled / Smoothened family
  100157360 (FZD6)
SSDB
Motif
Pfam: Frizzled Fz Folate_rec Integrin_alpha RseC_MucC
Other DBs
NCBI-GeneID: 100157360
NCBI-ProteinID: NP_001302679
Ensembl: ENSSSCG00000006052
UniProt: A0A076V355
LinkDB
Position
4
AA seq 712 aa
MEMFTFLWTCIFLPLIRGHSLFTCEPITVPRCMKMAYNMTFFPNLMGHYDQSIAAVEMEP
FLPLANLECSPNVETFLCKAFVPTCTEQIDVVPPCRKFCEKVYSDCKKLMDTFGIRWPEE
LECNRLQYCDEPVPATFDPHTDFLSPQKKIEPVQRDIGFWCPRHLKTSGGQGYKFLGIDQ
CAPPCPNMYFKNDELEFAKSFIGIVSIFCLCATLFTFLTFLIDVRRFRYPERPIIYYSVC
YSIVSLMYFIGFLLGNSTACNKADEKLELGDTVVLGSQNKACTVLFMFLYFFTMAGTVWW
VILTITWFLAAGRKWSCEAIEQKAVWFHAVAWGIPGFLTVMLLAMNKVEGDNISGVCFVG
LYDLDASRYFVLLPLCFCVFVGLSLLLAGIISLNHVRQVIQHDGRNQEKLKKFMIRIGVF
SGLYLVPLVMLLGCYVYEQVNRITWEITWVSDHCRQYHIPCPYQAKTETRPELALFMMKY
LMTLIVGISAVFWVGSKKTCTEWAGFFKRNRKKDPISESRRVLQESCEFFLKHNSKVKHK
KKHYKPSSHKLKVISKSMGTSTGATANHGTSAVAITNHDYLGQETLTEIQTSPETSVREV
RADRASPPKAREQDGEDPASSAASSSRLCGEQTDRKGRAGNVKDKSRVPASARSEGRVTP
KNDGTETSPAPSNSLQAPSSSEPGSLKGSTSLLVHSASGVRKEQGTGSHSDT
NT seq 2139 nt   +upstreamnt  +downstreamnt
atggaaatgtttacatttttgtggacatgtatttttctgcccctcataagagggcacagt
cttttcacctgtgaaccaattactgttcccagatgtatgaaaatggcctacaacatgaca
tttttccctaatttgatgggtcattatgaccagagtattgctgctgtggaaatggagcct
tttctccctcttgcgaatctggaatgttcaccaaatgttgaaactttcctttgcaaagct
tttgtaccaacctgcacagagcaaattgatgtggttccaccctgtcgtaaattttgtgag
aaagtatattctgattgcaaaaaattaatggatacttttgggatccgatggcctgaggaa
cttgaatgtaacaggttacaatactgtgacgaacctgttcctgcaacttttgatccacac
acagattttcttagtcctcagaagaaaatagaaccagtccaaagagacattggattttgg
tgtccaaggcatcttaagacttctgggggacaaggctataagtttcttggaattgaccag
tgtgcacctccatgccccaacatgtattttaagaatgatgagttggagtttgcaaaaagt
tttattggaatagtttcaatattttgtctttgtgcaactctgttcacattccttactttt
ttaattgatgttagaagattcagatacccagagagaccaattatatattactctgtctgt
tatagcattgtatctcttatgtactttattggattcttgctgggcaatagtacagcctgc
aataaggcagacgagaagctagaacttggtgacacagttgtcctaggctctcaaaataag
gcttgcaccgttttgtttatgtttttgtattttttcacaatggctggcactgtgtggtgg
gtgattcttaccattacttggttcttagctgctgggagaaagtggagttgtgaagccatt
gagcaaaaagcagtgtggtttcatgccgtggcctggggaataccaggttttctgaccgtt
atgcttcttgctatgaacaaagtggaaggagacaatattagtggagtttgctttgtcggt
ctttatgacctggatgcttctcgctactttgtactcttgccgctgtgcttttgtgtgttt
gttgggctgtctcttcttttagctggcattatttccttaaatcatgttcgacaagttata
cagcatgatggccggaaccaagagaagctaaagaaatttatgattcgaatcggagtcttc
agtggcctgtatcttgtgccattagtgatgcttcttggatgttatgtctatgagcaagtg
aacaggatcacctgggagataacttgggtctctgaccattgtcgtcagtaccatatacca
tgtccttatcaggcaaaaacagaaactcgaccagaattggcattatttatgatgaaatat
ttgatgactttaattgttggcatctctgctgtcttctgggtcggaagcaaaaagacatgc
acagaatgggctgggttttttaaacgaaatcgcaagaaagatccaatcagtgaaagccga
agagtactacaagagtcatgtgagtttttcttaaagcacaattctaaagttaaacacaaa
aagaagcactacaaaccaagttcacacaagctgaaggtcatttccaaatccatgggaacc
agcacaggagcgacagcaaatcatggcacttctgcagtagcaatcactaaccatgactac
ttaggacaagaaactttgacagaaatacaaacctcgccagaaacatcagtgagggaagtg
agagcggacagagctagcccgcccaaagcgagagaacaggacggtgaggaccctgcctcc
tcagcagcatccagctccagactctgcggggaacagaccgacaggaagggccgggcaggc
aatgtgaaggataagagccgagtgccggcaagtgcgcggagtgaaggaagggtaactcca
aagaacgatggcactgaaaccagcccggcaccgagcaacagcctgcaggcccccagttct
tcagagccaggcagcctcaaaggctccacatcactgcttgttcactcggcttcaggagtt
agaaaagagcagggcactggcagtcactcggatacttga

KEGG   Sus scrofa (pig): 100337669
Entry
100337669         CDS       T01009                                 

Gene name
FZD2
Definition
(RefSeq) frizzled-2 precursor
  KO
K02235  frizzled 2
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04150  mTOR signaling pathway
ssc04310  Wnt signaling pathway
ssc04390  Hippo signaling pathway
ssc04550  Signaling pathways regulating pluripotency of stem cells
ssc04916  Melanogenesis
ssc04934  Cushing syndrome
ssc05010  Alzheimer disease
ssc05022  Pathways of neurodegeneration - multiple diseases
ssc05165  Human papillomavirus infection
ssc05200  Pathways in cancer
ssc05205  Proteoglycans in cancer
ssc05217  Basal cell carcinoma
ssc05224  Breast cancer
ssc05225  Hepatocellular carcinoma
ssc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100337669 (FZD2)
   04390 Hippo signaling pathway
    100337669 (FZD2)
   04150 mTOR signaling pathway
    100337669 (FZD2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100337669 (FZD2)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100337669 (FZD2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100337669 (FZD2)
   05205 Proteoglycans in cancer
    100337669 (FZD2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100337669 (FZD2)
   05226 Gastric cancer
    100337669 (FZD2)
   05217 Basal cell carcinoma
    100337669 (FZD2)
   05224 Breast cancer
    100337669 (FZD2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100337669 (FZD2)
   05022 Pathways of neurodegeneration - multiple diseases
    100337669 (FZD2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100337669 (FZD2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100337669 (FZD2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:ssc04030]
    100337669 (FZD2)
G protein-coupled receptors [BR:ssc04030]
 Frizzled / Smoothened family
  100337669 (FZD2)
SSDB
Motif
Pfam: Frizzled Fz
Other DBs
NCBI-GeneID: 100337669
NCBI-ProteinID: NP_001182268
UniProt: D3K5N8
LinkDB
Position
12
AA seq 558 aa
MVLAVLGALPAGAGAQPYHGEKGISVPDHGFCQPISIPLCTDIAYNQTILPNLLGHTNQE
DAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLEQAIPPCRSICERARQGCEALMNK
FGFQWPERLRCEHFPRHGAEQICVGQNHSEDGAPALLTTAPPPGLQPGAGGTPGGPGGGG
SPPRYATLEHPFHCPRVLKVPSYLSYKFLGERDCAAPCEPARPDGSMFFSQEETRFARLW
ILTWSVLCCASTFFTVTTYLVDMQRFRYPERPIIFLSGCYTMVSVAYIAGFVLQERVVCN
ERFSEDGYRTVVQGTKKEGCTILFMMLYFFSMASSIWWVILSLTWFLAAGMKWGHEAIEA
NSQYFHLAAWAVPAVKTITILAMGQIDGDLLSGVCFVGLNSLDPLRGFVLAPLFVYLFIG
TSFLLAGFVSLFRIRTIMKHDGTKTEKLERLMVRIGVFSVLYTVPATIVIACYFYEQAFR
EHWERSWVSQHCKSLAIPCPAHYTPRMSPDFTVYMIKYLMTLIVGITSGFWIWSGKTLHS
WRKFYTRLTNSRHGETTV
NT seq 1677 nt   +upstreamnt  +downstreamnt
atggtgcttgcagtgctgggcgcactgcccgcgggcgccggggcgcagccgtaccacggc
gagaagggcatctcagtgccggaccacggcttctgccagcctatttccatccctctgtgc
acggacatcgcctacaaccagaccatcctgcccaacctgctgggtcacacgaaccaagaa
gatgcgggcctcgaggtgcaccagttctacccgctggtgaaggtgcagtgttctcccgag
ctgcgcttcttcctgtgctccatgtacgcacccgtgtgcaccgtgctggagcaggccatc
ccgccgtgtcgctccatctgcgagcgcgcgcgccagggctgcgaggcgctcatgaacaag
ttcggtttccagtggccggagcgcctacgctgcgagcacttcccccgccacggcgcggaa
cagatctgcgtgggccagaaccactccgaggacggggcgcccgcgctgctcaccaccgcg
ccgccgccgggcctgcagccgggtgctgggggcaccccgggcggcccgggcggcggcggc
tcgcccccgcgctacgccacgctggagcacccgttccactgcccgcgcgtccttaaggtg
ccgtcctatctcagctacaagttcctgggcgagcgcgactgcgcggcgccttgcgaaccc
gcgcggcccgacggctccatgttcttctctcaggaggaaacgcgttttgcgcgcctctgg
attctcacctggtcagtgttgtgctgcgcctccaccttcttcaccgtcactacgtacctg
gtggacatgcagcgcttccgctacccggagcggcccatcatctttctgtccggctgctac
actatggtgtcggtggcctacatcgcgggcttcgtgctccaggagcgcgtggtgtgtaac
gagcgcttctccgaggacggctaccgcacagtggtacaggggaccaagaaggagggctgc
accatcctcttcatgatgctctacttcttcagcatggccagttccatctggtgggtcatc
ctgtcgctcacctggttcctggcggcgggcatgaaatggggccacgaggccattgaagcc
aactcgcagtacttccacttggccgcgtgggccgtgcccgccgtcaaaaccatcacaatc
ctggccatgggccagattgacggcgacctgctgagcggcgtgtgcttcgtgggcctcaac
agcctggacccgctgcggggcttcgtgctggcgccgctcttcgtgtacctgttcataggc
acgtccttcctcctggccggtttcgtgtccctcttccgcatccgtaccatcatgaagcac
gatggcaccaagaccgagaagctggagaggctcatggtgcgcatcggcgtcttctcggtg
ctctacacggtgcccgccaccatcgtcatcgcctgctacttctacgagcaggccttccga
gagcactgggagcgctcgtgggtgagccagcactgcaagagcctggccatcccgtgcccg
gcgcactacactccgcgcatgtcgcccgacttcacggtctacatgatcaaatacctcatg
acgctcatcgtgggcatcacgtcgggcttctggatctggtccggcaagacgctgcactcg
tggaggaagttctacacccgtctcaccaacagccggcacggcgagaccaccgtgtga

KEGG   Sus scrofa (pig): 100511782
Entry
100511782         CDS       T01009                                 

Gene name
FZD10
Definition
(RefSeq) frizzled-10
  KO
K02842  frizzled 9/10
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04150  mTOR signaling pathway
ssc04310  Wnt signaling pathway
ssc04390  Hippo signaling pathway
ssc04550  Signaling pathways regulating pluripotency of stem cells
ssc04916  Melanogenesis
ssc04934  Cushing syndrome
ssc05010  Alzheimer disease
ssc05022  Pathways of neurodegeneration - multiple diseases
ssc05165  Human papillomavirus infection
ssc05200  Pathways in cancer
ssc05205  Proteoglycans in cancer
ssc05217  Basal cell carcinoma
ssc05224  Breast cancer
ssc05225  Hepatocellular carcinoma
ssc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100511782 (FZD10)
   04390 Hippo signaling pathway
    100511782 (FZD10)
   04150 mTOR signaling pathway
    100511782 (FZD10)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100511782 (FZD10)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100511782 (FZD10)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100511782 (FZD10)
   05205 Proteoglycans in cancer
    100511782 (FZD10)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100511782 (FZD10)
   05226 Gastric cancer
    100511782 (FZD10)
   05217 Basal cell carcinoma
    100511782 (FZD10)
   05224 Breast cancer
    100511782 (FZD10)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100511782 (FZD10)
   05022 Pathways of neurodegeneration - multiple diseases
    100511782 (FZD10)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100511782 (FZD10)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100511782 (FZD10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:ssc04030]
    100511782 (FZD10)
   04090 CD molecules [BR:ssc04090]
    100511782 (FZD10)
G protein-coupled receptors [BR:ssc04030]
 Frizzled / Smoothened family
  100511782 (FZD10)
CD molecules [BR:ssc04090]
 Proteins
  100511782 (FZD10)
SSDB
Motif
Pfam: Frizzled Fz
Other DBs
NCBI-GeneID: 100511782
NCBI-ProteinID: XP_003132905
Ensembl: ENSSSCG00000009751
Vega: OTTSUSG00000002349
UniProt: F1RFQ3
LinkDB
Position
14
AA seq 581 aa
MQRPSPRLWLVLQVMGSCAAISSMDMERPGDGKCQPIEIPMCKDIGYNMTRMPNLMGHEN
QREAAIQLHEFAPLVEYGCHGHLRFFLCSLYAPMCTEQVSTPIPACRVMCEQARLKCSPI
MEQFNFKWPDSLDCSKLPNKNDPNYLCMEAPNNGSDEPARGSGMFPPLFRPQRPHSAQEH
QLKDGGPGRAGCDNPGKFHHVEKSASCAPLCTPGVDVYWSRDDKHFAVVWLAVWSVLCFF
SSAFTVLTFLIDPARFRYPERPIIFLSMCYCVYSVGYIIRLFAGAESIACDRDIGQLYVI
QEGLESTGCTLVFLVLYYFGMASSLWWVILTLTWFLAAGKKWGHEAIEANSSYFHLAAWA
IPAVKTILILVMRRVAGDELTGVCYVGSMDTNALTGFVLIPLACYLIIGTSFILSGFVAL
FHIRRVMKTGGENTDKLEKLMVRIGVFSVLYTVPATCVIACYFYERLNVEYWKILARQHK
CQMNNQTKNLDCLMAASIPAVEIFMVKIFMLLVVGITSGMWIWTSKTLQSWQNVCSRRFK
KKSRRKPASVITSSGIYKKAQHPQKTHLGKYEIPTQPPTCV
NT seq 1746 nt   +upstreamnt  +downstreamnt
atgcagcgcccgagcccccgtctgtggctggtcctgcaggtgatgggctcgtgcgccgcc
atcagctccatggacatggagcgtccgggcgacggcaagtgccagcccatcgagatcccg
atgtgcaaggacattggctacaacatgacccgcatgcccaacctgatgggccacgagaac
cagcgcgaggccgccatccagctgcacgagttcgcgccgctggtggagtacggctgccac
ggccacctccgcttctttctgtgctccttgtacgcgcccatgtgcaccgagcaagtctcc
acccccatccccgcctgccgagtcatgtgcgagcaggcccggctcaagtgctccccgatc
atggagcagttcaacttcaagtggcccgactccctggactgcagcaaactccccaacaag
aacgaccccaattacctgtgtatggaggcgcccaataacggctcggacgagcccgcgcgg
ggctcgggcatgttccctccgctcttccggccgcagcggccccacagcgcacaggagcac
cagctgaaggatggggggccgggacgcgccggctgcgacaaccctggcaagttccaccac
gtggagaagagtgcgtcgtgcgcgccgctctgcacgccgggcgtggacgtgtactggagc
cgcgacgacaagcacttcgcggtggtctggctggccgtctggtccgtgctctgcttcttc
tccagcgccttcaccgtgctcaccttcctcatcgacccggcgcgcttcaggtaccccgag
cgccccatcatcttcctctccatgtgctactgcgtctactcggtgggctacatcatccgc
ctctttgccggcgccgagagcatcgcctgcgaccgggacatcgggcagctctacgtcatt
caggagggcctggagagcacgggctgcactctggtctttctggtcctctactacttcgga
atggccagctccctgtggtgggtgattctcactctcacctggttcctggctgcgggcaag
aagtggggccacgaggccatcgaggccaacagcagctacttccacctggccgcctgggcc
atcccggcggtgaagaccatcctgatcctggtgatgcgcagggtggcgggggacgagctg
accggtgtctgttacgtgggcagcatggacaccaacgccctcaccggcttcgtcctgatc
ccgctggcctgttacctcatcatcggcacctcctttattctctcgggctttgtggctctt
ttccacatccgaagggtgatgaaaacgggtggggaaaacacggacaaactcgagaagctc
atggtgaggatcggggtcttttctgtgctctacacggtgccagccacctgtgtgattgcc
tgctacttttatgaacgcctcaacgtggagtattggaaaatcctggccaggcagcacaaa
tgccaaatgaacaaccagacgaaaaacctggactgtctgatggccgcctccatccccgcg
gtggaaatcttcatggtgaagattttcatgctgctggtggtgggtatcaccagcggcatg
tggatctggacctccaagactctgcagtcctggcagaatgtttgcagccgcaggttcaag
aaaaagagccggcgaaaaccggccagcgtgatcactagcagtggaatttacaaaaaagcc
cagcatccccaaaaaacccatctggggaaatatgaaatccccacccagcctcccacctgt
gtgtga

KEGG   Sus scrofa (pig): 100513691
Entry
100513691         CDS       T01009                                 

Gene name
FZD7
Definition
(RefSeq) frizzled-7
  KO
K02432  frizzled 1/7
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04150  mTOR signaling pathway
ssc04310  Wnt signaling pathway
ssc04390  Hippo signaling pathway
ssc04550  Signaling pathways regulating pluripotency of stem cells
ssc04916  Melanogenesis
ssc04934  Cushing syndrome
ssc05010  Alzheimer disease
ssc05022  Pathways of neurodegeneration - multiple diseases
ssc05165  Human papillomavirus infection
ssc05200  Pathways in cancer
ssc05205  Proteoglycans in cancer
ssc05217  Basal cell carcinoma
ssc05224  Breast cancer
ssc05225  Hepatocellular carcinoma
ssc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100513691 (FZD7)
   04390 Hippo signaling pathway
    100513691 (FZD7)
   04150 mTOR signaling pathway
    100513691 (FZD7)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100513691 (FZD7)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100513691 (FZD7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100513691 (FZD7)
   05205 Proteoglycans in cancer
    100513691 (FZD7)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100513691 (FZD7)
   05226 Gastric cancer
    100513691 (FZD7)
   05217 Basal cell carcinoma
    100513691 (FZD7)
   05224 Breast cancer
    100513691 (FZD7)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100513691 (FZD7)
   05022 Pathways of neurodegeneration - multiple diseases
    100513691 (FZD7)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100513691 (FZD7)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100513691 (FZD7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:ssc04030]
    100513691 (FZD7)
G protein-coupled receptors [BR:ssc04030]
 Frizzled / Smoothened family
  100513691 (FZD7)
SSDB
Motif
Pfam: Frizzled Fz Dicty_CAR
Other DBs
NCBI-GeneID: 100513691
NCBI-ProteinID: XP_013839842
Ensembl: ENSSSCG00000016111
LinkDB
Position
15
AA seq 574 aa
MRGPRTAASPSPLGLCTMVLAVLGALPAGAGAQPYHGEKGISVPDHGFCQPISIPLCTDI
AYNQTILPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLDKAIPPC
RSLCERARQGCEALMNKFGFQWPERLRCENFPVHGAGEICVGQNTSDGSGGPGGGPTAYP
TAPYMPDLPFTALPPGAADGRGRSAFPFSCPRQLKVPPYLGYRFLGERDCGAPCEPGRAN
GLMYFKEEERRFARLWVGVWSVLCCASTLFTVLTYLVDMRRFSYPERPIIFLSGCYFMVA
VAHVAGFLLEDRAVCVERFSEDGYRTVAQGTKKEGCTILFMVLYFFGMASSIWWVILSLT
WFLAAGMKWGHEAIEANSQYFHLAAWAVPAVKTITILAMGQVDGDLLSGVCYVGLSSVDA
LRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKHDGTKTEKLEKLMVRIGVFSVLYTV
PATIVLACYFYEQAFREHWERTWLLQTCKSYAVPCPPGHFPPMSPDFTVFMIKYLMTMIV
GITTGFWIWSGKTLQSWRRFYHRLSHSSKGETAV
NT seq 1725 nt   +upstreamnt  +downstreamnt
atgcggggcccccgcacggcagcgtcgccctcgcctctgggcctgtgcaccatggtgctt
gcagtgctgggcgcactgcccgcgggcgccggggcgcagccgtaccacggcgagaagggc
atctcagtgccggaccacggcttctgccagcctatttccatccctctgtgcacggacatc
gcctacaaccagaccatcctgcccaacctgctgggtcacacgaaccaagaagatgcgggc
ctcgaggtgcaccagttctacccgctggtgaaggtgcagtgttctcccgagctgcgcttc
ttcctgtgctccatgtacgcacccgtgtgcaccgtgctcgataaggccatcccgccgtgc
cgttctctgtgcgagcgtgcccgccaggggtgtgaggcgctcatgaacaagttcggcttc
caatggcccgagcggctgcgttgcgagaacttccctgtgcacggcgccggcgagatctgc
gtgggccagaacacgtccgacggctccgggggcccaggcggcgggcccaccgcctatcct
acagcgccctacatgcccgacctgcccttcaccgcgctgcccccgggagccgctgacggc
aggggccgctcggccttccccttctcgtgcccccgccagctcaaggtgcccccctacctg
ggctaccgcttcctgggcgagcgcgactgcggcgccccctgcgagccgggccgcgccaac
ggcctcatgtactttaaggaggaggagaggcgcttcgcccgcctctgggtgggcgtgtgg
tcagtgctgtgctgcgcctcgacgctcttcacggtgctcacctacctagtggacatgcgg
cgcttcagctacccggagcggcccatcatcttcctgtcgggctgctacttcatggtggcc
gtggcgcacgtggccggcttcctgctggaggaccgcgccgtgtgcgtggagcgcttctca
gaagacggctaccgcacggtggcgcagggcaccaagaaggagggctgcaccatcctcttc
atggtgctctacttcttcggcatggccagttccatctggtgggtcatcttgtcgctcact
tggttcctggccgctggcatgaagtggggccacgaggccatcgaggccaactctcagtac
ttccacctggctgcgtgggcggtgcccgctgtcaagaccatcaccatcctggccatgggc
caggtggacggggacctgctcagcggggtttgctacgtgggcctgtccagcgtggacgcg
ctgcggggcttcgtgctggcgcccctgttcgtctacctcttcatcggcacgtccttcctg
ctggccggcttcgtgtcgcttttccgcatccgcaccatcatgaagcacgacggcaccaaa
acggagaagctggagaagctcatggtgcgcattggcgtcttcagcgtgctctacaccgtg
cccgccaccatcgtcctggcctgttacttctacgagcaggccttccgcgaacactgggag
cgcacctggctcctgcagacgtgcaagagctacgcggttccctgcccgcccggccacttc
ccgcccatgagccctgacttcaccgtcttcatgatcaaatacctgatgaccatgatcgta
ggcatcaccacgggcttctggatctggtccggcaagaccctgcagtcgtggcgccgcttc
taccacagactcagccacagcagcaagggggagacggcggtatga

KEGG   Sus scrofa (pig): 100519058
Entry
100519058         CDS       T01009                                 

Gene name
FZD5
Definition
(RefSeq) frizzled-5
  KO
K02375  frizzled 5/8
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04150  mTOR signaling pathway
ssc04310  Wnt signaling pathway
ssc04390  Hippo signaling pathway
ssc04550  Signaling pathways regulating pluripotency of stem cells
ssc04916  Melanogenesis
ssc04934  Cushing syndrome
ssc05010  Alzheimer disease
ssc05022  Pathways of neurodegeneration - multiple diseases
ssc05165  Human papillomavirus infection
ssc05200  Pathways in cancer
ssc05205  Proteoglycans in cancer
ssc05217  Basal cell carcinoma
ssc05224  Breast cancer
ssc05225  Hepatocellular carcinoma
ssc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100519058 (FZD5)
   04390 Hippo signaling pathway
    100519058 (FZD5)
   04150 mTOR signaling pathway
    100519058 (FZD5)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100519058 (FZD5)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100519058 (FZD5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100519058 (FZD5)
   05205 Proteoglycans in cancer
    100519058 (FZD5)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100519058 (FZD5)
   05226 Gastric cancer
    100519058 (FZD5)
   05217 Basal cell carcinoma
    100519058 (FZD5)
   05224 Breast cancer
    100519058 (FZD5)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100519058 (FZD5)
   05022 Pathways of neurodegeneration - multiple diseases
    100519058 (FZD5)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100519058 (FZD5)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100519058 (FZD5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:ssc04030]
    100519058 (FZD5)
G protein-coupled receptors [BR:ssc04030]
 Frizzled / Smoothened family
  100519058 (FZD5)
SSDB
Motif
Pfam: Frizzled Fz
Other DBs
NCBI-GeneID: 100519058
NCBI-ProteinID: XP_005672190
Ensembl: ENSSSCG00000016140
UniProt: F1SSU5
LinkDB
Position
15
AA seq 586 aa
MARPDPSAPPSLLLLLLAQLAGRATAASKAPVCQEITVPMCRGIGYNLTHMPNQFNHDTQ
DEAGLEVHQFWPLVEIHCSPDLRFFLCSMYTPICLPDYHKPLPPCRSVCERAKAGCSPLM
RQYGFAWPERMSCDRLPVLGRDAEVLCMDYNRSEATTAPPRPFPAKPTLSGPPGAPASGS
DCVAGGPSVCKCREPFVPILKESHPLYNKVRTGQVPNCAVPCYQPSFSPDERTFATFWIG
LWSVLCFISTSTTVATFLIDMERFRYPERPIIFLSACYLCVSLGFLVRLVVGHASVACSR
EHSHIHYETTGPALCTVVFLLVYFFGMASSIWWVILSLTWFLAAGMKWGNEAIAGYAQYF
HLAAWLIPSVKSITALALSSVDGDPVAGICYVGNQNLNSLRGFVLGPLVLYLLVGTLFLL
AGFVSLFRIRSVIKQGGTKTDKLEKLMIRIGIFTLLYTVPASIVVACYLYEQHYRESWEA
ALTCACPGPDAGQPRAKPEYWVLMLKYFMCLVVGITSGVWIWSGKTVESWRRFTSRCCCR
PRRGHKSGGATATGDYAEASAALTGRTGPPGPAAATYHKQVSLSHV
NT seq 1761 nt   +upstreamnt  +downstreamnt
atggctcggcctgacccgtccgcgccgccttcgctgctgctgctgctcttggcgcagctg
gcgggccgggcgacggccgcttccaaggcgccggtgtgccaggaaatcacagtgcctatg
tgccgcggcatcggctacaacctgacgcacatgcccaaccagttcaaccacgacacgcag
gacgaggcgggcctcgaggtgcaccagttctggccgttggtggagatccactgctcgccg
gacctgcgcttcttcctgtgctccatgtacacgcccatctgcctgcccgactaccacaag
ccgctgccgccgtgccgctcggtgtgcgagcgcgccaaggccggctgctcgccgctcatg
cgccagtacggctttgcctggccggaacgcatgagctgcgaccgcctcccggtgctgggc
cgcgacgccgaggtcctgtgcatggattacaaccgcagcgaggccaccacggcgcccccc
aggcccttcccggccaagcccaccctctcaggccctccgggggcgccggcctcagggagc
gactgcgtcgccgggggcccgtcggtgtgcaagtgccgcgagcccttcgtgcccattctg
aaggagtcgcaccccctttacaacaaagtgcggacgggccaggtacccaactgcgcggta
ccctgctaccagccgtcctttagcccggacgagcgcacgttcgccaccttctggatcggc
ctgtggtctgtgctgtgcttcatctccacttccaccacggtggccaccttcttaatagac
atggaacgcttccgctaccctgagcgccccatcatctttctgtcagcctgctacctgtgc
gtgtcgctgggcttcctggtgcgcctagtcgtgggccatgccagcgtcgcctgcagccgt
gagcacagccacatccactacgagacaacgggccctgcgctgtgcactgtcgtcttcctg
ctagtctacttcttcggcatggccagctccatctggtgggtcatcctgtcgctcacctgg
ttcttggcagctggcatgaagtggggcaatgaggccatcgcgggctatgcacagtacttc
cacctggctgcttggctcatccccagtgtcaagtccatcactgcgctggccctgagctcg
gtggatggggacccggtggccggtatctgctacgtggggaaccagaacctgaactcgctg
cgtggcttcgtgctgggcccgctggtgctctacctgctggtgggcacgctcttcctcctg
gcaggcttcgtgtcgctcttccgcatccgcagcgtcatcaagcagggcggcaccaagacg
gacaagctggaaaagctcatgatccgcatcggcatcttcacgctgctctacacggtgcct
gccagcatcgtggtggcctgctacctgtacgaacagcactatcgcgagagttgggaggct
gcgctcacctgcgcgtgcccaggccccgacgccgggcagccacgtgccaagcctgagtac
tgggtgctcatgctcaaatacttcatgtgcctggtggtgggcatcacgtcaggcgtctgg
atttggtctggcaagactgtggagtcgtggcggcgcttcaccagccgctgctgctgccgc
ccgcggcggggccacaagagcggcggggccacggccaccggggactacgccgaggccagc
gcagcgctcacaggcaggaccgggccacccggccctgccgccgccacctatcacaagcag
gtgtccctgtctcacgtgtag

KEGG   Sus scrofa (pig): 100520319
Entry
100520319         CDS       T01009                                 

Gene name
FZD4
Definition
(RefSeq) LOW QUALITY PROTEIN: frizzled-4
  KO
K02354  frizzled 4
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04150  mTOR signaling pathway
ssc04310  Wnt signaling pathway
ssc04390  Hippo signaling pathway
ssc04550  Signaling pathways regulating pluripotency of stem cells
ssc04916  Melanogenesis
ssc04934  Cushing syndrome
ssc05010  Alzheimer disease
ssc05022  Pathways of neurodegeneration - multiple diseases
ssc05165  Human papillomavirus infection
ssc05200  Pathways in cancer
ssc05205  Proteoglycans in cancer
ssc05217  Basal cell carcinoma
ssc05224  Breast cancer
ssc05225  Hepatocellular carcinoma
ssc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100520319 (FZD4)
   04390 Hippo signaling pathway
    100520319 (FZD4)
   04150 mTOR signaling pathway
    100520319 (FZD4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100520319 (FZD4)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100520319 (FZD4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100520319 (FZD4)
   05205 Proteoglycans in cancer
    100520319 (FZD4)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100520319 (FZD4)
   05226 Gastric cancer
    100520319 (FZD4)
   05217 Basal cell carcinoma
    100520319 (FZD4)
   05224 Breast cancer
    100520319 (FZD4)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100520319 (FZD4)
   05022 Pathways of neurodegeneration - multiple diseases
    100520319 (FZD4)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100520319 (FZD4)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100520319 (FZD4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:ssc04030]
    100520319 (FZD4)
   04090 CD molecules [BR:ssc04090]
    100520319 (FZD4)
G protein-coupled receptors [BR:ssc04030]
 Frizzled / Smoothened family
  100520319 (FZD4)
CD molecules [BR:ssc04090]
 Proteins
  100520319 (FZD4)
SSDB
Motif
Pfam: Frizzled Fz Chol_subst-bind
Other DBs
NCBI-GeneID: 100520319
NCBI-ProteinID: XP_005667267
Ensembl: ENSSSCG00000014920
Vega: OTTSUSG00000002350
UniProt: A0A480XCK5 A0A4X1U400
LinkDB
Position
9
AA seq 537 aa
MAWRGTGPRVLGEPGGVGLSLRLLLLLLXLLGPARGFGDEEERRCDPIRISMCQNLGYNV
TKMPNLVGHELQTDAELQLTTFTPLIQYGCSSQLQFFLCSVYVPMCTEKVNIPIGPCGGM
CLSVKRRCEPVLKEFGFAWPESLNCSKFPPQNDHNHMCMEGPGDEEVPLPHKTPIQPGEE
CHSVGTNSEQYIWVKRSLNCVLKCGYDAGLYSRSAKEFTDIWMAVWASLCFISTAFTVLT
FLIDSSRFSYPERPIIFLSMCYNIYSIAYIVRLTVGRERISCDFEEAAEPVLIQEGLKNT
GCAIIFLLMYFFGMASSIWWVILTLTWFLAAGLKWGHEAIEMHSSYFHIAAWAIPAVKTI
VILIMRLVDADELTGLCYVGNQNLDALTGFVVAPLFTYLVIGTLFIAAGLVALFKIRSNL
QKDGTKTDKLERLMVKIGVFSVLYTVPATCVIACYFYEISNWALFRFSADDSNMAVEMLK
IFMSLLVGITSGMWIWSAKTLHTWQKCSNRLVNSGKVKREKRGNGWVKPGRGSETVV
NT seq 1614 nt   +upstreamnt  +downstreamnt
atggcctggcggggcacagggccgcgcgtcctgggggagcccgggggcgtcggtctcagt
ctgcggctgctgctgctgctgctgntgctcctggggccagcacggggcttcggggacgag
gaggagcggcgctgcgaccccatccgcatctccatgtgccagaacctgggctacaacgtg
accaagatgcccaacctggtggggcacgagctgcagacggacgccgagctgcagctgaca
actttcacgccgctcatccagtacggctgctccagccagctgcagttcttcctttgctcg
gtgtatgtgccaatgtgcacggagaaggtcaacatccccatcggcccctgcggtggcatg
tgcctttcggtcaagagacgctgcgagcccgtcctgaaggaattcggattcgcctggccg
gagagcctgaactgcagcaaattccccccccagaatgaccacaaccacatgtgcatggaa
gggccaggggacgaggaggtgcccttacctcacaaaacccccatccagcccggggaagag
tgccactccgtgggaaccaactccgagcagtacatctgggtgaagaggagcctgaactgc
gttctcaagtgcggctacgacgccggcctgtacagccgctcggccaaggagttcacagat
atctggatggccgtgtgggccagcctgtgcttcatctccaccgccttcaccgtgctgacc
ttcctgatcgattcgtccaggttttcctacccggagcgccccatcatatttctcagtatg
tgctataatatttatagcatcgcttatattgtcaggctgaccgtaggccgggaaaggata
tcctgcgattttgaagaggcagcagaacctgttctcatccaagaaggacttaagaacaca
ggatgtgcaatcattttcttgctgatgtacttttttggaatggccagttccatctggtgg
gttattctaacactcacttggtttttggcagcgggactcaagtggggtcatgaagccata
gaaatgcacagctcttatttccacattgcagcctgggccatccctgcagtgaaaaccatt
gtcatcttgattatgagactggtggatgcggatgaactgacgggcctgtgctacgtgggg
aaccagaacctcgatgccctcacgggctttgtggtggcgcccctcttcacttacctggtg
atcggaactttgttcattgctgcgggcttggtggccttgttcaagatccggtcgaacctt
cagaaggacgggacaaagacagacaagttggaaaggctgatggtcaagattggggtcttc
tcagtcctgtacacggtgcccgcaacctgtgtgatcgcctgttatttctatgaaatctcc
aactgggcgctcttccggttttctgcagacgactccaatatggcggttgaaatgttaaaa
atttttatgtcgctgctggtaggcatcacttcaggcatgtggatttggtctgccaaaact
ctgcacacgtggcagaagtgttccaacagattggtgaattctgggaaggtaaagagagaa
aagcgagggaatggttgggtgaagcctgggagaggcagcgaaactgtggtataa

KEGG   Sus scrofa (pig): 100625784
Entry
100625784         CDS       T01009                                 

Gene name
FZD9
Definition
(RefSeq) frizzled-9
  KO
K02842  frizzled 9/10
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04150  mTOR signaling pathway
ssc04310  Wnt signaling pathway
ssc04390  Hippo signaling pathway
ssc04550  Signaling pathways regulating pluripotency of stem cells
ssc04916  Melanogenesis
ssc04934  Cushing syndrome
ssc05010  Alzheimer disease
ssc05022  Pathways of neurodegeneration - multiple diseases
ssc05165  Human papillomavirus infection
ssc05200  Pathways in cancer
ssc05205  Proteoglycans in cancer
ssc05217  Basal cell carcinoma
ssc05224  Breast cancer
ssc05225  Hepatocellular carcinoma
ssc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100625784 (FZD9)
   04390 Hippo signaling pathway
    100625784 (FZD9)
   04150 mTOR signaling pathway
    100625784 (FZD9)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100625784 (FZD9)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100625784 (FZD9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100625784 (FZD9)
   05205 Proteoglycans in cancer
    100625784 (FZD9)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100625784 (FZD9)
   05226 Gastric cancer
    100625784 (FZD9)
   05217 Basal cell carcinoma
    100625784 (FZD9)
   05224 Breast cancer
    100625784 (FZD9)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100625784 (FZD9)
   05022 Pathways of neurodegeneration - multiple diseases
    100625784 (FZD9)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100625784 (FZD9)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100625784 (FZD9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:ssc04030]
    100625784 (FZD9)
   04090 CD molecules [BR:ssc04090]
    100625784 (FZD9)
G protein-coupled receptors [BR:ssc04030]
 Frizzled / Smoothened family
  100625784 (FZD9)
CD molecules [BR:ssc04090]
 Proteins
  100625784 (FZD9)
SSDB
Motif
Pfam: Frizzled Fz 7tm_2 Dicty_CAR
Other DBs
NCBI-GeneID: 100625784
NCBI-ProteinID: XP_013850981
Ensembl: ENSSSCG00000023004
LinkDB
Position
3
AA seq 591 aa
MAVPPLRRALLLWQLLAAAGGAALEIGRFDPERGRGPAPCQAVEIPMCRGIGYNLTRMPN
LLGHTSQGEAAAELAEFAPLVQYGCHSHLRFFLCSLYAPMCTDQVSTPIPACRPMCEQAR
QRCAPIMEQFNFGWPDSLDCARLPTRNDPHALCMEAPENATAGPAEPHKGLGMLPVAPRP
ARPPGDAAPGPGGGTCENPEKFQYVEKSRSCAPRCGPGVEVFWSRRDKDFALVWMAVWSA
LCFFSTAFTVLTFLLEPHRFQYPERPIIFLSMCYNVYSLAFLIRAVAGAQSVACDQEAGA
LYVIQEGLENTGCTLVFLLLYYFGMASSLWWVVLTLTWFLAASKKWGHEAIEAHGSYFHM
VAWGLPALKTIVILTLRKVAGDELTGLCYVANMDAAALTGFVLVPLSCYLVLGTSFLLTG
FVALFHIRKIMKTGGTNTEKLEKLMVKIGVFSILYTVPATCVIVCYVYERLNMDFWRLRA
TEQPCSAATLPGGRRDCSLQDGSVPTVAVFMLKIFMSLVVGITSGVWVWSSKTFQTWQSL
CHRKMAAGRARAKACRASGGYGRGTHCHYKAPTVVLHMTKTDPSLENPTHL
NT seq 1776 nt   +upstreamnt  +downstreamnt
atggccgtgccgccactccgccgggcgctgctgctgtggcagctgctggcggcagcgggc
ggcgcagcgctggagatcggccgcttcgacccagagcgcgggcgcggtcccgcgccgtgc
caggcggtggagattcccatgtgccgcggcatcggctacaacctgacccgcatgcccaac
ctgctgggccacacgtcgcagggcgaggcggccgccgagctggccgagttcgcgccgctt
gtacagtacggctgccacagccacctgcgcttcttcctgtgctcgctctacgcgcccatg
tgcacagaccaggtctcgacgcccatccccgcctgccggcccatgtgcgagcaggcgcgc
cagcgctgtgcgcctatcatggagcagttcaactttggctggccagactctcttgactgt
gcccggctgcccacccgcaacgacccgcacgccctctgcatggaggcgcctgagaatgcc
acggccggccctgccgagccccacaagggactgggcatgttgcccgtggcaccacgaccc
gcgcggccccccggagatgctgccccgggccctggcggtggcacctgtgagaacccggag
aagttccagtatgtggagaaaagccgctcatgcgcgccgcgctgcgggcctggcgtcgag
gtgttctggtctcggcgcgacaaggacttcgcgctcgtctggatggcagtgtggtcggcc
ttgtgcttcttctccactgccttcactgtgctcacctttctgctggagcctcaccgcttc
cagtacccggagcgccccatcatcttcctctccatgtgctacaacgtctactcgctagcc
ttcctcatccgggcggtggccggggcccagagcgtggcctgcgaccaggaggcaggtgcc
ctctacgtgatccaggagggcctggagaacaccggctgcaccctcgtcttcctgctgctc
tactactttggcatggccagttcactgtggtgggtggtgctgactctcacctggttcctg
gcggccagcaagaaatggggccacgaggccatcgaggcgcatggcagctacttccacatg
gtggcctggggcctgcctgcgctcaagaccattgtgatcctgaccctgcgcaaggtggca
ggggatgagctgactgggctctgttacgtggccaacatggatgcagccgcgctcacgggc
ttcgtgctggtgcccctctcctgctatctggtcctgggcaccagcttcctcctgaccggc
ttcgtggccctcttccacatccgcaagatcatgaagaccgggggcaccaacacagagaag
ctggagaagctcatggtgaagatcggggtcttctccatcctctacacagtgcccgccacc
tgcgtcattgtgtgctacgtctacgaacggctcaacatggacttctggcgcctgcgggcc
acagagcagccctgctcagcagccaccttgcccgggggtcggagggactgctcgctgcag
gatggctcggtgcccactgtggctgtctttatgctcaaaatcttcatgtcactggtggtg
ggcatcaccagcggcgtctgggtatggagctccaagactttccagacctggcagagtctg
tgccaccgcaagatggcagctggcagggcccgggcaaaggcctgccgggcctccgggggc
tatggccgtggcacccactgccactataaggcccccactgtggtcttgcacatgactaag
acggacccttctctggagaaccccacacacctctag

KEGG   Sus scrofa (pig): 110255708
Entry
110255708         CDS       T01009                                 

Gene name
FZD8
Definition
(RefSeq) LOW QUALITY PROTEIN: frizzled-8
  KO
K02375  frizzled 5/8
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04150  mTOR signaling pathway
ssc04310  Wnt signaling pathway
ssc04390  Hippo signaling pathway
ssc04550  Signaling pathways regulating pluripotency of stem cells
ssc04916  Melanogenesis
ssc04934  Cushing syndrome
ssc05010  Alzheimer disease
ssc05022  Pathways of neurodegeneration - multiple diseases
ssc05165  Human papillomavirus infection
ssc05200  Pathways in cancer
ssc05205  Proteoglycans in cancer
ssc05217  Basal cell carcinoma
ssc05224  Breast cancer
ssc05225  Hepatocellular carcinoma
ssc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    110255708 (FZD8)
   04390 Hippo signaling pathway
    110255708 (FZD8)
   04150 mTOR signaling pathway
    110255708 (FZD8)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    110255708 (FZD8)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    110255708 (FZD8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110255708 (FZD8)
   05205 Proteoglycans in cancer
    110255708 (FZD8)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    110255708 (FZD8)
   05226 Gastric cancer
    110255708 (FZD8)
   05217 Basal cell carcinoma
    110255708 (FZD8)
   05224 Breast cancer
    110255708 (FZD8)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110255708 (FZD8)
   05022 Pathways of neurodegeneration - multiple diseases
    110255708 (FZD8)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110255708 (FZD8)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110255708 (FZD8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:ssc04030]
    110255708 (FZD8)
G protein-coupled receptors [BR:ssc04030]
 Frizzled / Smoothened family
  110255708 (FZD8)
SSDB
Motif
Pfam: Frizzled Fz
Other DBs
NCBI-GeneID: 110255708
NCBI-ProteinID: XP_020920647
LinkDB
Position
10
AA seq 692 aa
MEWGYLLEVTSLLAALALLQRSSGAAAASAKELACQEITVPLCKGIGYNYTYMPNQFNHD
TQDEAGLEVHQFWPLVEIQCSPDLKFFLCSMYTPICLEDYKKPLPPCRSVCERAKAGCAP
LMRQYGFAWPDRMRCDRLPEQGNPDTLCMDYNRTDLTTAAPSPPRRPPPPPPPREQPPSG
SGHGRPPGARPPSRGRGGGGDAAAPPARGGGGGGGGGGGGKARPPGGGAAPCEPGCQCRA
PMVSVSSERHPLYNRVKTGQIANCALPCHNPFFSQDERAFTVFWIGLWSVLCFVSTFATV
STFLIDMERFKYPERPIIFLSACYLFVSVGYLVRLVAGHEKVACSGGAGAAGGAGGAGSA
AAGAGAAGAGAGGPGGRGEYEELGAVEQHVRYETTGPALCTVVFLLVYFFGMASSIWWVI
LSLTWFLAAGMKWGNEAIAGYSQYFHLAAWLVPSVKSIAVLALSSVDGDPVAGICYVGNQ
SLDNLRGFVLAPLVIYLFIGTMFLLAGFVSLFRIRSVIKQQGGPTKTHKLEKLMIRLGLF
TVLYTVPAAVVVACLFYEQHNRPRWEATHNCPCLRDLQPDQARRPDYAVFMLKYFMCLVV
GITSGVWVWSGKTLESWRALCTRCCWASKGAGATGAGPGGGGPGGGGPGAGGGGGPGGGA
GSLYSDVSTGLTWRSGTASSVSYPKQMPLSQV
NT seq 2079 nt   +upstreamnt  +downstreamnt
atggagtggggttacctgttggaagtgacctcgttgctggccgccctggcgttgctgcag
cgctcgagcggcgcggcggccgcctcggccaaggagctggcgtgccaggagatcaccgtg
ccgctgtgcaagggcatcggctacaactacacctacatgcccaaccagttcaaccacgac
acgcaggacgaggcgggcctggaggtgcaccaattctggccgctggtggagatccagtgc
tcgcccgacctcaagttcttcctgtgcagcatgtacacacccatctgtctggaggactac
aagaagcccctgcctccctgccgctcggtgtgcgagcgcgccaaggccggctgcgcgccc
ctcatgcgccagtacggcttcgcctggcctgaccgcatgcgctgcgaccggctgcccgag
cagggcaaccccgacacgctgtgcatggactacaaccgcaccgacctcaccacggccgcg
cccagcccaccgcgccgcccgccgccgccgccgccgccgcgagagcagccgccctccggc
agcggccacggccgcccgccgggggcccggcccccgtcccgcggcaggggcggcggcggg
gacgcggctgcgccccccgcgcgcggcggcggcggcggcggcggcggtggtggcggcggg
aaggcgcggccccctggcggcggcgcggcgccctgcgagccgggctgccaatgccgcgct
cccatggtgagcgtgtccagcgagcggcaccctctctacaaccgcgtcaagaccggccag
atcgccaactgcgcgctgccctgccacaacccgttcttcagccaggacgagcgcgccttc
accgtcttctggatcggcctgtggtcggtgctctgcttcgtgtccactttcgccaccgtc
tccaccttcctcatagacatggagcgcttcaagtacccggagcggcccatcatcttcctc
tcggcctgctacctcttcgtgtccgtcggctacctggtgcgcctggtggcgggccacgag
aaggtggcgtgcagcggcggtgcgggggctgcgggcggcgcgggcggcgcgggcagcgcg
gcggcgggagccggcgcggcgggagcgggcgcgggcggcccgggagggcgcggcgagtac
gaggagctgggcgccgtggagcagcacgtgcgctatgagaccacgggcccggcgctgtgc
accgtggtcttcctgctcgtctacttcttcggcatggccagctccatctggtgggtgatc
ctgtcgctcacgtggttcctggcggcgggcatgaagtggggcaacgaggccatcgccggc
tactcgcagtacttccacctggccgcctggctcgtgcccagcgtcaagtctatcgccgtg
ctggcgctcagctcggtggacggcgatccggtggcgggcatctgctacgtgggcaaccag
agcctggacaacctgcgcggcttcgtgctggcgccgctggtcatctacctcttcatcggc
accatgttcctgctggccggcttcgtgtcgctcttccgcatccgctcggtcatcaagcag
cagggaggccccaccaagacgcacaaactggagaagctcatgatccgcctgggcctcttc
accgtgctctacaccgtgcccgccgctgtcgtggtcgcctgtctcttctacgaacagcac
aaccgcccgcgctgggaggccacgcacaactgcccatgcctgcgggacctgcagccggac
caggcgcgccggcccgactacgccgtcttcatgctcaagtacttcatgtgcctggtggtg
ggcatcacctcgggcgtgtgggtctggtccggcaagacgctcgagtcgtggcgcgcgctg
tgcacccgctgctgctgggccagcaagggcgcgggcgccacgggcgcgggcccggggggc
ggcggcccggggggcggtggcccgggggctggcgggggcggggggccgggcggcggggcg
ggctccctctacagcgacgtcagcaccggcctgacgtggcgatctggcacggctagctcc
gtgtcttatccaaagcagatgccattgtcccaggtctga

KEGG   Sus scrofa (pig): 110262227
Entry
110262227         CDS       T01009                                 

Gene name
FZD1
Definition
(RefSeq) frizzled-1
  KO
K02432  frizzled 1/7
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04150  mTOR signaling pathway
ssc04310  Wnt signaling pathway
ssc04390  Hippo signaling pathway
ssc04550  Signaling pathways regulating pluripotency of stem cells
ssc04916  Melanogenesis
ssc04934  Cushing syndrome
ssc05010  Alzheimer disease
ssc05022  Pathways of neurodegeneration - multiple diseases
ssc05165  Human papillomavirus infection
ssc05200  Pathways in cancer
ssc05205  Proteoglycans in cancer
ssc05217  Basal cell carcinoma
ssc05224  Breast cancer
ssc05225  Hepatocellular carcinoma
ssc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    110262227 (FZD1)
   04390 Hippo signaling pathway
    110262227 (FZD1)
   04150 mTOR signaling pathway
    110262227 (FZD1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    110262227 (FZD1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    110262227 (FZD1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110262227 (FZD1)
   05205 Proteoglycans in cancer
    110262227 (FZD1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    110262227 (FZD1)
   05226 Gastric cancer
    110262227 (FZD1)
   05217 Basal cell carcinoma
    110262227 (FZD1)
   05224 Breast cancer
    110262227 (FZD1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110262227 (FZD1)
   05022 Pathways of neurodegeneration - multiple diseases
    110262227 (FZD1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110262227 (FZD1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110262227 (FZD1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:ssc04030]
    110262227 (FZD1)
G protein-coupled receptors [BR:ssc04030]
 Frizzled / Smoothened family
  110262227 (FZD1)
SSDB
Motif
Pfam: Frizzled Fz 7tm_2 Dicty_CAR
Other DBs
NCBI-GeneID: 110262227
NCBI-ProteinID: XP_020958020
LinkDB
Position
9
AA seq 643 aa
MAEEEAPKKYPAAPGGASWELCSAALRTGPGAEGSGYAGSLRRPPADSGRLALRLLLLLW
LLEAPLLLGVRAQAAGQGPGPGQQPPPPQQQQSGQQYNGERGISIPDHGYCQPISIPLCT
DIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSAELKFFLCSMYAPVCTVLEQALP
PCRSLCERARQGCEALMNKFGFQWPDTLKCEKFPVHGAGELCVGQNTSDKGTPTPSLLPE
FWTSNPQHGGGGHRGGGFPGGAGASERGKFSCPRALKVPSYLNYHFLGEKDCGAPCEPTK
VYGLMYFGPEELRFSRTWIGIWSVLCCASTLFTVLTYLVDMRRFSYPERPIIFLSGCYTA
VAVAYIAGFLLEDRVVCNDKFSEDGARTVAQGTKKEGCTILFMMLYFFSMASSIWWVILS
LTWFLAAGMKWGHEAIEANSQYFHLAAWAVPAIKTITILALGQVDGDVLSGVCFVGLNNV
DALRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKHDGTKTEKLEKLMVRIGVFSVLY
TVPATIVIACYFYEQAFRDQWERSWVAQSCKSYAIPCPHLQAGGGAPPHPPMSPDFTVFM
IKYLMTLIVGITSGFWIWSGKTLNSWRKFYTRLTNSKQGETTV
NT seq 1932 nt   +upstreamnt  +downstreamnt
atggctgaggaggaggcgcctaagaagtacccggccgcccccggcggcgcgagctgggaa
ctttgttccgcggcgctccgtacgggaccgggggcagaagggagcgggtacgcgggcagc
ctccgccgccccccggctgactccggacgcttggcgctccggctgctcctactgctttgg
ctgctggaggctccgctgctgctgggggtccgagcgcaggcagccggccaggggcccggg
ccggggcagcagcccccgccgcctcagcagcaacagagcgggcagcagtacaacggcgag
aggggcatctctataccggaccacggctactgccagcccatctccatcccgctgtgcacg
gacatcgcgtacaaccaaaccatcatgcccaacctgctgggccacacgaatcaggaggat
gcgggcctcgaggtgcaccagttctacccgctggtgaaggtgcagtgctctgcagagctt
aagttcttcctgtgctccatgtacgcgcccgtgtgcactgtgctggagcaagctctgccg
ccttgccgctccctgtgcgagcgcgcgcgccagggctgcgaagcgcttatgaacaagttc
ggtttccagtggcctgacacgctcaagtgcgagaagttcccggtgcacggcgccggcgag
ctgtgcgtgggccagaacacttcggacaagggcacccctacgccctcgctactgcctgag
ttctggaccagcaacccccaacacggcggcggagggcaccggggtggcggcttcccgggg
ggcgccggcgcgtcggagcgaggcaagttttcgtgccctcgcgccctcaaggtgccctcc
tacctcaactaccacttcctgggggagaaggactgcggcgcaccctgcgagccgaccaag
gtgtacgggcttatgtactttgggccagaagagctgcgcttctcgcgcacctggatcggc
atctggtcagtgctgtgctgcgcctccacccttttcaccgtgctcacgtacctggtggac
atgcggcgcttcagctacccagagcggcccatcatcttcctgtcgggctgctacactgca
gtagccgtggcctacatcgccggcttcctgctggaggaccgggtggtgtgtaacgacaag
ttctccgaggacggggcgcgtacagtggcgcagggcaccaagaaggagggctgcaccatc
ctcttcatgatgctctacttcttcagcatggccagctccatctggtgggtgatcttgtcg
ctcacctggttcctggcagccggcatgaagtggggccacgaagccatcgaggctaactcg
cagtactttcacctggccgcctgggctgtgccggccatcaaaaccatcaccatcctggcg
ctgggccaggtggacggcgatgtgctgagcggggtgtgcttcgtggggctcaacaacgtg
gacgcgctgcggggcttcgtgctggcgccactcttcgtgtacctgttcatcggcacgtct
ttcctactggccggcttcgtgtccctcttccgtattcgcaccatcatgaagcatgatggc
accaagacagagaagctggagaagcttatggtgcgcatcggtgtcttcagcgtactttac
acggtgccagctactattgtcatcgcctgctacttctatgagcaggccttccgggaccag
tgggaacgcagctgggtggcccagagctgcaagagctatgccatcccctgcccccacctc
caggcgggtggaggcgccccgccgcacccgcccatgagccctgactttacagtcttcatg
atcaagtaccttatgacgctgatcgtgggtatcacgtcaggcttctggatctggtcgggc
aagaccctcaactcctggaggaagttctacactaggcttaccaacagcaaacagggggag
accaccgtctga

DBGET integrated database retrieval system