KEGG   Sus scrofa (pig): 100153846
Entry
100153846         CDS       T01009                                 

Gene name
E2F1
Definition
(RefSeq) transcription factor E2F1
  KO
K17454  transcription factor E2F1
Organism
ssc  Sus scrofa (pig)
Pathway
ssc01522  Endocrine resistance
ssc04110  Cell cycle
ssc04137  Mitophagy - animal
ssc04218  Cellular senescence
ssc04934  Cushing syndrome
ssc05160  Hepatitis C
ssc05161  Hepatitis B
ssc05163  Human cytomegalovirus infection
ssc05165  Human papillomavirus infection
ssc05166  Human T-cell leukemia virus 1 infection
ssc05167  Kaposi sarcoma-associated herpesvirus infection
ssc05169  Epstein-Barr virus infection
ssc05200  Pathways in cancer
ssc05206  MicroRNAs in cancer
ssc05212  Pancreatic cancer
ssc05214  Glioma
ssc05215  Prostate cancer
ssc05218  Melanoma
ssc05219  Bladder cancer
ssc05220  Chronic myeloid leukemia
ssc05222  Small cell lung cancer
ssc05223  Non-small cell lung cancer
ssc05224  Breast cancer
ssc05225  Hepatocellular carcinoma
ssc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    100153846 (E2F1)
  09143 Cell growth and death
   04110 Cell cycle
    100153846 (E2F1)
   04218 Cellular senescence
    100153846 (E2F1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100153846 (E2F1)
   05206 MicroRNAs in cancer
    100153846 (E2F1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100153846 (E2F1)
   05225 Hepatocellular carcinoma
    100153846 (E2F1)
   05226 Gastric cancer
    100153846 (E2F1)
   05214 Glioma
    100153846 (E2F1)
   05220 Chronic myeloid leukemia
    100153846 (E2F1)
   05218 Melanoma
    100153846 (E2F1)
   05219 Bladder cancer
    100153846 (E2F1)
   05215 Prostate cancer
    100153846 (E2F1)
   05224 Breast cancer
    100153846 (E2F1)
   05222 Small cell lung cancer
    100153846 (E2F1)
   05223 Non-small cell lung cancer
    100153846 (E2F1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100153846 (E2F1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100153846 (E2F1)
   05161 Hepatitis B
    100153846 (E2F1)
   05160 Hepatitis C
    100153846 (E2F1)
   05163 Human cytomegalovirus infection
    100153846 (E2F1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100153846 (E2F1)
   05169 Epstein-Barr virus infection
    100153846 (E2F1)
   05165 Human papillomavirus infection
    100153846 (E2F1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100153846 (E2F1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ssc03000]
    100153846 (E2F1)
Transcription factors [BR:ssc03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    100153846 (E2F1)
SSDB
Motif
Pfam: E2F_CC-MB E2F_TDP TP1
Other DBs
NCBI-GeneID: 100153846
NCBI-ProteinID: XP_020933351
Ensembl: ENSSSCG00000007268
LinkDB
Position
17
AA seq 520 aa
MGGGECERAWHRPDKACARPILRLAVLPRAAAPSRPPPPWPGLCRQRRPGAERDPERDRA
LASACCHGPAPPPPTATRAARAVSAMAVAPAGGPCAPALEALLGAGALRLLDSSQIVIIS
TAQDASAPAAPAGPAAPATGPRDPDLLLFATPQAPRPTPSAPRPALGRPPVKRRLDLETD
HQYLAESSGPARGRGRHPGKGVKSPGEKSRYETSLNLTTKRFLELLSRSADGVVDLNWAA
EVLKVQKRRIYDITNVLEGIQLIAKKSKNHIQWLGSHAAVGIGGRLEGLTQDLQQLQESE
RQLDHLIQICTTQLHLLSEDADSQRLAYVTCQDLRSIADPAEQMVMVIKAPPETQLQAVD
SSENFQISLKSKQGPIDVFLCPEESTGGISPGKTPSQGVASGEEGRAADPTTAVPPPPSS
PPASPATDPSQSLLSLEQEPLLSRMGGLRAPVDEDRLSPLVAADSLLEHVREDFSSLLPE
EFISLSPPQEALDYHFGLEEGEGIRDLFDCDFGDLTPLDF
NT seq 1563 nt   +upstreamnt  +downstreamnt
atggggggcggggagtgcgaacgcgcctggcaccgccccgacaaagcctgcgcgcgcccc
atcctgcgattggcggtgcttcctcgcgccgccgccccgtcccgccctccgccgccgtgg
ccgggactttgcaggcagcggcggccgggggcggagcgggatccggagcgggatcgagcc
ctcgcctcggcctgctgccatgggcccgcgccgccgccgccgactgccacccgggccgcg
cgggccgtgagcgccatggccgtggcccccgcgggcggcccatgcgcgccggcgctggag
gccctgctcggggccggcgcgctgcggctgctcgactcctcgcagatcgtcatcatctcc
accgcgcaggacgccagcgccccagcggcccccgccggccccgccgcgcccgccaccggc
ccccgcgaccccgacctgctgctcttcgccacgccgcaggcgccccggcccacccccagc
gcgccgcgccccgcgctcggccgcccgccggtgaagcgaaggctggacctagaaactgac
catcaatacttggccgagagcagcgggccagctcggggcagaggccgccacccaggaaaa
ggtgtgaaatccccaggggagaagtcacgctatgagacatcgctgaatctgaccaccaaa
cgcttcctggaattgctgagccgctcggctgacggtgtcgtcgacctgaactgggcagct
gaggtgctgaaggtgcagaaacggcgcatctacgacatcaccaacgtcctcgagggcatc
cagctcatcgccaagaagtccaagaaccacatccagtggctaggcagccatgcagcagtg
gggattggtggccggcttgaaggattgacccaggacctgcagcaactgcaggaaagcgag
cggcagctggaccatctgatccaaatctgtaccacacagctgcatctgctttccgaggat
gctgacagccagcgcctggcctacgtgacctgccaggaccttcgtagcatcgcggaccct
gcagagcagatggtcatggtgatcaaggcccccccggagacccagctccaagccgtggac
tcctccgagaacttccagatctcccttaagagcaaacaaggccccatcgatgttttcctg
tgccctgaggagagtacaggcgggatcagccccgggaagaccccatcccagggggtagct
tctggggaggagggcagggcagccgaccccaccactgcagtgccgccaccaccatcatcg
ccccctgcatcccctgccacggatcccagtcagtccctgctcagcctggagcaagaacct
ctgctttcccggatgggtggcctgcgggcccctgtggacgaggaccgcctgtccccgctg
gtggcggccgactcgctcctggagcatgtacgggaggacttctccagcctcctccccgag
gagttcatcagcctgtcccccccccaggaggcccttgactaccactttggccttgaggag
ggggagggcatcagagacctcttcgactgtgactttggggacctcacccccctggatttc
tga

KEGG   Sus scrofa (pig): 100154407
Entry
100154407         CDS       T01009                                 

Gene name
E2F3
Definition
(RefSeq) transcription factor E2F3 isoform X1
  KO
K06620  transcription factor E2F3
Organism
ssc  Sus scrofa (pig)
Pathway
ssc01522  Endocrine resistance
ssc04110  Cell cycle
ssc04218  Cellular senescence
ssc04934  Cushing syndrome
ssc05160  Hepatitis C
ssc05161  Hepatitis B
ssc05163  Human cytomegalovirus infection
ssc05166  Human T-cell leukemia virus 1 infection
ssc05167  Kaposi sarcoma-associated herpesvirus infection
ssc05169  Epstein-Barr virus infection
ssc05200  Pathways in cancer
ssc05206  MicroRNAs in cancer
ssc05212  Pancreatic cancer
ssc05214  Glioma
ssc05215  Prostate cancer
ssc05218  Melanoma
ssc05219  Bladder cancer
ssc05220  Chronic myeloid leukemia
ssc05222  Small cell lung cancer
ssc05223  Non-small cell lung cancer
ssc05224  Breast cancer
ssc05225  Hepatocellular carcinoma
ssc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100154407 (E2F3)
   04218 Cellular senescence
    100154407 (E2F3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100154407 (E2F3)
   05206 MicroRNAs in cancer
    100154407 (E2F3)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100154407 (E2F3)
   05225 Hepatocellular carcinoma
    100154407 (E2F3)
   05226 Gastric cancer
    100154407 (E2F3)
   05214 Glioma
    100154407 (E2F3)
   05220 Chronic myeloid leukemia
    100154407 (E2F3)
   05218 Melanoma
    100154407 (E2F3)
   05219 Bladder cancer
    100154407 (E2F3)
   05215 Prostate cancer
    100154407 (E2F3)
   05224 Breast cancer
    100154407 (E2F3)
   05222 Small cell lung cancer
    100154407 (E2F3)
   05223 Non-small cell lung cancer
    100154407 (E2F3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100154407 (E2F3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100154407 (E2F3)
   05161 Hepatitis B
    100154407 (E2F3)
   05160 Hepatitis C
    100154407 (E2F3)
   05163 Human cytomegalovirus infection
    100154407 (E2F3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100154407 (E2F3)
   05169 Epstein-Barr virus infection
    100154407 (E2F3)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100154407 (E2F3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ssc03000]
    100154407 (E2F3)
Transcription factors [BR:ssc03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    100154407 (E2F3)
SSDB
Motif
Pfam: E2F_CC-MB E2F_TDP
Other DBs
NCBI-GeneID: 100154407
NCBI-ProteinID: XP_020954055
LinkDB
Position
7
AA seq 466 aa
MRKGIQPALEQYLVTAGGGEGAAVVATAAAASMDKRALLASPGFPAAAAAAAAAPSAYIQ
ILTTNTSTTSCSSSLQSGAVAAGPLLPSAPGVEQTAGSLLYTTPHGPSSRAGLLQQPPAL
GRGGSGGGGGPPAKRRLELGESGQQYLADGLKTPKGKGRAALRSPDSPKTPKSPSEKTRY
DTSLGLLTKKFIQLLSQSPDGVLDLNKAAEVLKVQKRRIYDITNVLEGIHLIKKKSKNNV
QWMGCSLSEDGGTLAQCQGLSKEVTELSQEEKKLDELIQSCTLDLKLLTEDSENQRLAYV
TYQDIRKISGLKDQTVIVVKAPPETRLEVPDPIESLQIHLASTQGPIEVYLCPEETETHS
PMKTNNQDHNGNIPKPTSKDLASTNSGHSDCSISMANLSPLASPANLLQQTEDQIPSNLE
GPFVNLLPPLLQEDYLLSLGEEEGISDLFDAYDLEKLPLVEDFMCS
NT seq 1401 nt   +upstreamnt  +downstreamnt
atgagaaaggggatccagcccgccctggagcagtacctggtgaccgccgggggtggggag
ggggcggctgtcgtcgccaccgccgctgcagcctccatggacaaaagggcactgctagcc
agccccggcttccccgccgccgccgccgctgctgccgccgccccgagcgcatacatccag
atcctcaccacgaacacttccaccacctcctgttcctcctccctccaaagcggcgccgtc
gccgccggccccctcctccccagtgcccccggcgtggagcagaccgccggcagcctcctc
tacaccacgccgcacggaccctccagcagagccgggctgctgcagcagccaccagcgctg
ggacgcggcggcagcggcggcggcggcggccctccggcgaagcgcaggctggagctagga
gagagcggtcagcagtacctcgcagatggtttaaaaacccccaagggcaaagggagagct
gcgctgcgaagtccagatagccccaaaactccaaaatctccctcagaaaaaacacggtat
gatacatcccttggtctgctcaccaagaagttcattcagctactgagccaatcacctgat
ggggtcttggatttgaacaaagcagcagaggtgctgaaggtgcaaaagagaaggatttac
gacatcaccaatgtactggaaggcatccacctcattaagaagaagtctaaaaacaacgtg
cagtggatgggctgcagtctgtctgaggacgggggcacgctggcccagtgtcaaggcctg
tcaaaagaagtgaccgagctcagtcaggaagagaagaaattagatgaactgatccaaagc
tgcaccctggacctcaaactgttaaccgaggattcagagaatcaaaggttagcttatgtt
acatatcaagatattcgaaaaattagtggccttaaagaccaaactgttatagttgtgaaa
gcccctccagaaacaagacttgaagtgcctgacccaatagagagcctacaaatacatttg
gcaagtacccaaggacccattgaggtttatttgtgtccagaagagactgaaacacacagt
ccaatgaaaacaaacaaccaagaccacaatgggaatatccctaaacccacttccaaagac
ttggcttcaaccaactcaggacatagtgattgctcgatttctatggcaaacctttctcct
ttggcctccccagccaaccttttacagcagactgaggaccaaattccttccaacctagaa
ggaccatttgtgaacttactgcctcccctgctccaagaagactatctcctaagccttggg
gaggaagaaggcatcagcgatctctttgatgcttatgatttggaaaagctcccactggtg
gaagactttatgtgtagttga

KEGG   Sus scrofa (pig): 110261113
Entry
110261113         CDS       T01009                                 

Gene name
E2F2
Definition
(RefSeq) transcription factor E2F2
  KO
K09389  transcription factor E2F2
Organism
ssc  Sus scrofa (pig)
Pathway
ssc01522  Endocrine resistance
ssc04110  Cell cycle
ssc04218  Cellular senescence
ssc04934  Cushing syndrome
ssc05160  Hepatitis C
ssc05161  Hepatitis B
ssc05163  Human cytomegalovirus infection
ssc05166  Human T-cell leukemia virus 1 infection
ssc05167  Kaposi sarcoma-associated herpesvirus infection
ssc05169  Epstein-Barr virus infection
ssc05200  Pathways in cancer
ssc05206  MicroRNAs in cancer
ssc05212  Pancreatic cancer
ssc05214  Glioma
ssc05215  Prostate cancer
ssc05218  Melanoma
ssc05219  Bladder cancer
ssc05220  Chronic myeloid leukemia
ssc05222  Small cell lung cancer
ssc05223  Non-small cell lung cancer
ssc05224  Breast cancer
ssc05225  Hepatocellular carcinoma
ssc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    110261113 (E2F2)
   04218 Cellular senescence
    110261113 (E2F2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110261113 (E2F2)
   05206 MicroRNAs in cancer
    110261113 (E2F2)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    110261113 (E2F2)
   05225 Hepatocellular carcinoma
    110261113 (E2F2)
   05226 Gastric cancer
    110261113 (E2F2)
   05214 Glioma
    110261113 (E2F2)
   05220 Chronic myeloid leukemia
    110261113 (E2F2)
   05218 Melanoma
    110261113 (E2F2)
   05219 Bladder cancer
    110261113 (E2F2)
   05215 Prostate cancer
    110261113 (E2F2)
   05224 Breast cancer
    110261113 (E2F2)
   05222 Small cell lung cancer
    110261113 (E2F2)
   05223 Non-small cell lung cancer
    110261113 (E2F2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110261113 (E2F2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110261113 (E2F2)
   05161 Hepatitis B
    110261113 (E2F2)
   05160 Hepatitis C
    110261113 (E2F2)
   05163 Human cytomegalovirus infection
    110261113 (E2F2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110261113 (E2F2)
   05169 Epstein-Barr virus infection
    110261113 (E2F2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    110261113 (E2F2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ssc03000]
    110261113 (E2F2)
Transcription factors [BR:ssc03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    110261113 (E2F2)
SSDB
Motif
Pfam: E2F_CC-MB E2F_TDP
Other DBs
NCBI-GeneID: 110261113
NCBI-ProteinID: XP_020951186
LinkDB
Position
6
AA seq 437 aa
MLRGPRVLAPAAGPPPTGLPAMSPTELWPPGLSSPQLCQATTTYYTQLYPQTMPPAAAPG
TCLDATPHGPEGQAVRCVPAGRLPAKRKLDLEGIGRPAVPEFRTPKGKCIRVDGLPSPKT
PKSPGEKTRYDTSLGLLTKKFIYLLSESEDGVLDLNWAAEVLDVQKRRIYDITNVLEGIQ
LIRKKAKNNIQWVGRGLFEDPTRPGKQQQLGQELKELMSMEQALDQLIQSCSLNFKHLTE
DKANKRLAYVTYQDIRAVGNFKEQTVIAVKAPPQTRLEVPDRSEENLQIYLKSTQGPIEV
YLCPEEVQEPDSPTKEPLVSTSALSPSPDSTQPSSSTSPGITEPTASSAPALTSQQVPPP
PPQSLVPLEATDSMLELPHPLLQQTEDQFLSPTLPGSSPLLSFSPPLDQDDYLWGLDGGE
GISDLFDSYDLGDLLIN
NT seq 1314 nt   +upstreamnt  +downstreamnt
atgctgcgagggccccgggtcctggctcctgccgcggggccgccccccactggactgccc
gcgatgagccccaccgagctgtggccgcccggccttagcagcccccagctctgccaggcc
accaccacctactacacccagctgtacccgcagactatgcctcccgccgcagcgccgggc
acctgcctcgacgccaccccccacggaccggagggccaagctgtgcgatgcgtgccggct
ggccggctgccggccaaaaggaagctggacctggaggggatcgggaggcctgcggtccct
gaattccggactcccaaggggaagtgcattagagtggatggcctccccagccccaaaacc
cccaagtctcctggggagaagactcgctatgacacgtcgctggggctgctcaccaagaag
ttcatttacctcctgagcgagtccgaggatggggtcctggacctgaactgggctgctgag
gtgctggatgtgcagaagcggcgcatctatgacatcaccaatgtgctggagggcatccag
ctcatccgcaagaaggccaagaacaacatccagtgggtaggcaggggactctttgaagac
cccacccggcctgggaagcagcagcagctggggcaggagctgaaggagctgatgagcatg
gagcaggccttggaccagctcatccagagctgctctctgaacttcaagcacctgacggag
gacaaggccaacaagagactggcctacgtgacttaccaggacatccgagctgtgggcaac
tttaaggagcagacggtgatcgctgtcaaggcccctccacagacaagactggaagtgcct
gaccggagcgaggagaacctgcagatatatctgaagagtacgcaggggcccatcgaggtc
tacctatgcccggaagaggtgcaagagcctgacagtcctaccaaggagcccctcgtctcc
acatccgctctcagccccagccctgactccacccagcccagcagcagcaccagccctggg
atcacagaacctaccgcatcctcagcgccagccctgacgtcccagcaagtcccaccacca
cccccgcaatcccttgtccccctggaggccaccgacagcatgctggagctgccacaccca
cttctgcagcagactgaggaccagttcctatcgccgaccctgccaggcagctcccctctg
ctcagcttctccccacccctggaccaggatgactacctgtggggcctggatggtggggag
ggcatcagtgacctcttcgactcctatgaccttggagacctgctgattaactga

DBGET integrated database retrieval system