KEGG   Sus scrofa (pig): 100153922
Entry
100153922         CDS       T01009                                 

Gene name
TCF7L2
Definition
(RefSeq) transcription factor 7-like 2 isoform X26
  KO
K04491  transcription factor 7-like 2
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04310  Wnt signaling pathway
ssc04390  Hippo signaling pathway
ssc04520  Adherens junction
ssc04916  Melanogenesis
ssc04934  Cushing syndrome
ssc05132  Salmonella infection
ssc05165  Human papillomavirus infection
ssc05167  Kaposi sarcoma-associated herpesvirus infection
ssc05200  Pathways in cancer
ssc05210  Colorectal cancer
ssc05213  Endometrial cancer
ssc05215  Prostate cancer
ssc05216  Thyroid cancer
ssc05217  Basal cell carcinoma
ssc05221  Acute myeloid leukemia
ssc05224  Breast cancer
ssc05225  Hepatocellular carcinoma
ssc05226  Gastric cancer
ssc05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100153922 (TCF7L2)
   04390 Hippo signaling pathway
    100153922 (TCF7L2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    100153922 (TCF7L2)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100153922 (TCF7L2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100153922 (TCF7L2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100153922 (TCF7L2)
   05225 Hepatocellular carcinoma
    100153922 (TCF7L2)
   05226 Gastric cancer
    100153922 (TCF7L2)
   05216 Thyroid cancer
    100153922 (TCF7L2)
   05221 Acute myeloid leukemia
    100153922 (TCF7L2)
   05217 Basal cell carcinoma
    100153922 (TCF7L2)
   05215 Prostate cancer
    100153922 (TCF7L2)
   05213 Endometrial cancer
    100153922 (TCF7L2)
   05224 Breast cancer
    100153922 (TCF7L2)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100153922 (TCF7L2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100153922 (TCF7L2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100153922 (TCF7L2)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    100153922 (TCF7L2)
   05165 Human papillomavirus infection
    100153922 (TCF7L2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ssc03000]
    100153922 (TCF7L2)
Transcription factors [BR:ssc03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    100153922 (TCF7L2)
SSDB
Motif
Pfam: CTNNB1_binding HMG_box HMG_box_2
Other DBs
NCBI-GeneID: 100153922
NCBI-ProteinID: XP_001928730
Ensembl: ENSSSCG00000010638
UniProt: A0A481CE29
LinkDB
Position
14
AA seq 598 aa
MPQLNGGGGDDLGANDELISFKDEGEQEEKSSENSSAERDLADVKSSLVNESETNQNSSS
DSEAERRPPPRSESFRDKSRESLEEAAKRQDGGLFKGPPYPGYPFIMIPDLTSPYLPNGS
LSPTARTYLQMKWPLLDVQAGTLQSRQALKDARSPSPAHIVSNKVPVVQHPHHVHPLTPL
ITYSNEHFTPGNPPPHLPADVDPKTGIPRPPHPPDISPYYPLSPGTVGQIPHPLGWLVPQ
QGQPVYPITTGGFRHPYPTALTVNASMSRFPPHMVPPHHTLHTTGIPHPAIVTPTVKQES
SQSDVSSLHSAKHQDSKKEEEKKKPHIKKPLNAFMLYMKEMRAKVVAECTLKESAAINQI
LGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKKRKRDKQPGETNEHSE
CFLNPCLSLPPITDLSAPKKCRARFGLDQQNNWCGPCRRKKKCVRYIQGEGSCLSPPSSD
GSLLDSPPSSPHLLGSPPQDAKSQTEQTQPLSLSLKPDPLAHLSMMPPPPALLLAEAAHG
KAPALCANGALDLPPAALQAPLLPSSSLAQPSTSSLHSHNSLAGTQPQPLSLVTKSLE
NT seq 1797 nt   +upstreamnt  +downstreamnt
atgccgcagctgaacggcggtggaggagatgacctaggcgccaacgacgaactgatttcc
ttcaaagacgagggcgagcaggaggagaagagctccgaaaactcctcggcagagagggat
ttagctgatgtcaaatcgtctctagtcaatgaatcagaaacgaatcaaaacagctcctcc
gattccgaggcggaaagacggcctccgcctcgctccgaaagtttccgagataaatcccgg
gaaagtttggaagaagcggccaagaggcaagatggagggctctttaaggggccaccgtat
cccggctaccccttcatcatgatccccgacctgacgagcccctacctccccaacggatcg
ctctcgcccaccgcccgaacctatcttcagatgaaatggccgctgcttgacgttcaggcg
gggaccctccagagcagacaagccctcaaggatgcgcgctctccgtcgccggcacacatc
gtctcgaacaaagtgccggttgtgcaacaccctcaccatgtccaccctctcacgcctctt
atcacgtacagcaatgaacacttcacgccgggaaacccacctccacacttaccagctgac
gtagaccccaaaacaggaatcccacggcctccgcaccctccagatatatctccgtattac
ccgctatcgcccggcaccgtaggacaaatcccccatccgctaggatggttagtaccacag
cagggtcagccagtgtaccccatcacgacaggaggattccgtcacccctaccccacagct
ctgacggtcaacgcttccatgtccaggttccctccccacatggtccctccgcatcacact
ctccacacgaccggcatcccccacccggccatagtcacgcccacagtcaagcaggaatcc
tcgcagagtgacgtcagctccctccacagcgcaaagcatcaggactccaaaaaggaagaa
gagaagaagaagccccacataaagaaaccccttaacgcgttcatgttgtatatgaaggaa
atgagagcgaaggtcgtagctgagtgcacgttgaaagaaagtgcagccatcaaccagatc
ctgggccgaaggtggcacgcactgtccagagaagagcaagcgaagtactacgagctggcc
cggaaggagcgacagcttcacatgcagctgtaccccggctggtccgcacgggataactat
gggaaaaagaagaagaggaaaagggacaagcagcccggggagaccaatgaacacagcgaa
tgtttcctaaatccttgcctttcacttcctccgattacagacctgagcgctcctaagaaa
tgccgagcgcgctttggccttgatcaacagaataactggtgcggcccttgcaggagaaaa
aaaaagtgcgttcgctacatacaaggtgaaggcagctgcctcagtccaccctcttcagat
ggaagcttactagactcgcctccttcctccccccacctgctaggctcccctccccaagac
gccaagtcacagactgagcagacccagcctctgtcgctgtccctgaagcccgaccccctg
gcccacctgtccatgatgcctccgccgcccgccctcctgctggccgaggccgcccacggc
aaggcccccgccctctgtgccaacggggccctggacctgcctcccgccgccctgcaggcc
cccctcctcccctcctcatctctggcacagccgtcgacatcttccttacattcccacaac
tctctggccgggacccagccccagccgctctccctggtcaccaagtctttagaatag

KEGG   Sus scrofa (pig): 100170126
Entry
100170126         CDS       T01009                                 

Gene name
LEF1
Definition
(RefSeq) lymphoid enhancer-binding factor 1
  KO
K04492  lymphoid enhancer-binding factor 1
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04310  Wnt signaling pathway
ssc04390  Hippo signaling pathway
ssc04520  Adherens junction
ssc04916  Melanogenesis
ssc04934  Cushing syndrome
ssc05132  Salmonella infection
ssc05167  Kaposi sarcoma-associated herpesvirus infection
ssc05200  Pathways in cancer
ssc05210  Colorectal cancer
ssc05213  Endometrial cancer
ssc05215  Prostate cancer
ssc05216  Thyroid cancer
ssc05217  Basal cell carcinoma
ssc05221  Acute myeloid leukemia
ssc05224  Breast cancer
ssc05225  Hepatocellular carcinoma
ssc05226  Gastric cancer
ssc05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100170126 (LEF1)
   04390 Hippo signaling pathway
    100170126 (LEF1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    100170126 (LEF1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100170126 (LEF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100170126 (LEF1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100170126 (LEF1)
   05225 Hepatocellular carcinoma
    100170126 (LEF1)
   05226 Gastric cancer
    100170126 (LEF1)
   05216 Thyroid cancer
    100170126 (LEF1)
   05221 Acute myeloid leukemia
    100170126 (LEF1)
   05217 Basal cell carcinoma
    100170126 (LEF1)
   05215 Prostate cancer
    100170126 (LEF1)
   05213 Endometrial cancer
    100170126 (LEF1)
   05224 Breast cancer
    100170126 (LEF1)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100170126 (LEF1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100170126 (LEF1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100170126 (LEF1)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    100170126 (LEF1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ssc03000]
    100170126 (LEF1)
Transcription factors [BR:ssc03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    100170126 (LEF1)
SSDB
Motif
Pfam: CTNNB1_binding HMG_box HMG_box_2
Other DBs
NCBI-GeneID: 100170126
NCBI-ProteinID: NP_001123439
Ensembl: ENSSSCG00000009148
UniProt: B3GQS6 A0A4X1UVU7
LinkDB
Position
8
AA seq 398 aa
MPQLSGAGGGGGDPELCATDEMIPFKDEGDPQKEKIFAEISHPEEEGDLADIKSSLVNES
EIIPASNGHEVARQAQSSQESYHDKAREHPDDGKHPDGGLYNKGPSYSSYSGYIMMPNMN
NDPYMSNGSLSPPIPRTSNKVPVVQPSHAVHPLTPLITYSDEHFSPGSHPSHIPSDVNSK
QGMSRHPPAPEIPTFYPLSPGGVGQITPPLGWQGQPVYPITGGFRQPYPSSLSVDTSMSR
FSHHMIPGPPGPHTTGIPHPAIVTPQVKQEHPHTDSDLMHVKPQHEQRKEQEPKRPHIKK
PLNAFMLYMKEMRANVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQ
LYPGWSARDNYGKKKKRKREKLQESTSGTGPRMTAAYI
NT seq 1197 nt   +upstreamnt  +downstreamnt
atgccccaactctccggggcaggcggcggcgggggggacccggaactctgcgccacggac
gagatgatccccttcaaggacgagggcgatccccagaaagagaagattttcgctgagatc
agtcaccctgaagaggaaggtgacttagccgacatcaagtcctccttggttaacgagtcc
gaaatcatcccggcgagcaacggacacgaggtggccagacaagcacagagctctcaggag
tcctaccatgacaaggccagagaacaccctgatgacggaaagcatccagatggaggcctc
tacaacaaggggccctcttactcgagttattccggatacataatgatgccaaatatgaat
aatgacccatacatgtcaaatggatctctttctccacccatcccgagaacatcaaataaa
gtgcccgtggtgcagccgtcccatgcagtccatcctctcactcccctcatcacttacagc
gacgagcacttttctccaggatcacacccatcacacatcccatcagatgtcaactccaaa
caaggcatgtccagacaccctccagctcctgagatccctactttttatcccctgtctccg
ggtggtgttggacagattaccccacctcttggctggcaaggtcagcctgtatatcccatc
acgggaggattcaggcaaccctacccatcctcactgtcagtcgacacttccatgtccagg
ttttctcatcatatgattcctggtcctcctggtccccacacaactggcatccctcatcca
gctattgtaacgcctcaggtcaaacaagaacacccccacactgacagtgacctaatgcac
gtgaagcctcagcatgaacagagaaaggagcaagagccaaaaagacctcacattaagaag
cctctgaatgcttttatgttatacatgaaagaaatgagagcgaacgtcgtagctgagtgt
actctaaaggaaagtgcagctatcaaccagattctaggcagaaggtggcatgccctctcc
cgtgaagaacaggctaaatattatgaattagcacggaaggaaagacagctacatatgcag
ctctatccaggctggtctgcaagagacaattatggtaagaaaaagaagaggaagagagag
aaactacaggaatctacatcaggtacaggtccaagaatgacagctgcctacatttga

KEGG   Sus scrofa (pig): 100512951
Entry
100512951         CDS       T01009                                 

Gene name
TCF7
Definition
(RefSeq) transcription factor 7 isoform X1
  KO
K02620  transcription factor 7
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04310  Wnt signaling pathway
ssc04390  Hippo signaling pathway
ssc04520  Adherens junction
ssc04550  Signaling pathways regulating pluripotency of stem cells
ssc04916  Melanogenesis
ssc04934  Cushing syndrome
ssc05132  Salmonella infection
ssc05165  Human papillomavirus infection
ssc05167  Kaposi sarcoma-associated herpesvirus infection
ssc05200  Pathways in cancer
ssc05210  Colorectal cancer
ssc05213  Endometrial cancer
ssc05215  Prostate cancer
ssc05216  Thyroid cancer
ssc05217  Basal cell carcinoma
ssc05221  Acute myeloid leukemia
ssc05224  Breast cancer
ssc05225  Hepatocellular carcinoma
ssc05226  Gastric cancer
ssc05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100512951 (TCF7)
   04390 Hippo signaling pathway
    100512951 (TCF7)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    100512951 (TCF7)
   04550 Signaling pathways regulating pluripotency of stem cells
    100512951 (TCF7)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100512951 (TCF7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100512951 (TCF7)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100512951 (TCF7)
   05225 Hepatocellular carcinoma
    100512951 (TCF7)
   05226 Gastric cancer
    100512951 (TCF7)
   05216 Thyroid cancer
    100512951 (TCF7)
   05221 Acute myeloid leukemia
    100512951 (TCF7)
   05217 Basal cell carcinoma
    100512951 (TCF7)
   05215 Prostate cancer
    100512951 (TCF7)
   05213 Endometrial cancer
    100512951 (TCF7)
   05224 Breast cancer
    100512951 (TCF7)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100512951 (TCF7)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100512951 (TCF7)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100512951 (TCF7)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    100512951 (TCF7)
   05165 Human papillomavirus infection
    100512951 (TCF7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ssc03000]
    100512951 (TCF7)
Transcription factors [BR:ssc03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    100512951 (TCF7)
SSDB
Motif
Pfam: CTNNB1_binding HMG_box HMG_box_2
Other DBs
NCBI-GeneID: 100512951
NCBI-ProteinID: XP_020940414
LinkDB
Position
2
AA seq 566 aa
MPQLDSGGGGASGGDDLGAPDELLAFQDEGEEQDDKSRDSAVGPERDLAELKSSLVNESE
GAAGDAGVPGAGARARGEAEVGAEALGREHTSQRLFSDKLPESLEDGLKAPECASGMYKD
TVYSAFNLLMHYPPPSGAGQHPQPQPPLHKASQPSHGVPQLSPLYEHFSSPHPTPAPADI
SQKQGVHRPLQTPDLSGFYSLTSGSMGQLPHTVSWPSPPLYPLSPSCGYRQHFPAPTAAP
GAPYPRFTHPPLMLGSGVPGHHAAIPHPAIVPPSGKQELQPYDRSLKTQAESKGEKEAKK
PTIKKPLNAFMLYMKEMRAKVIAECTLKESAAINQILGRRWHALSREEQAKYYELARKER
QLHMQLYPGWSARDNYGKKKRRSREKHQDSNTDPGSPKKCRARFGLNQQTDWCGPCRRKK
KCIRYLPGEGRCPSPVPSDDSALGCPKSPAPQDSPSYLLLPHFPTELLASPAEPAPTSPG
LSAALSLPAPWAPSGLSQRPAEYTGTATAIAEKGSLACTGHTASSRSPLSEKRRQSPKAR
GNRPGALLTLSQGPSPREFRGCPTSA
NT seq 1701 nt   +upstreamnt  +downstreamnt
atgccgcagctggactcgggcgggggcggcgcgagcggcggcgacgacctcggcgcgccg
gacgagctgctggccttccaggacgagggcgaggagcaggacgacaagagccgcgacagc
gccgtgggccccgagcgcgacctggccgagctcaagtcgtcgctggtcaatgagtccgag
ggcgcggccggcgacgctggggtcccgggggcgggcgccagggcccgcggcgaggccgag
gtcggggccgaggctctcgggcgggaacacacttcgcagagacttttctccgacaaactt
ccagagtctctggaagatggcctgaaggccccggagtgcgccagcggcatgtacaaagac
accgtctactccgccttcaatctgctcatgcactacccacccccctcgggagcagggcag
cacccccagccgcagcccccgctgcacaaagccagtcagccttcccacggcgtcccccag
ctctctcctctctatgaacatttcagcagtccgcaccccacacctgcaccagctgacatc
agccagaagcaaggagttcacaggccgctgcagacccctgacctctccggcttctactct
ctgacctcgggcagcatgggacagctcccccacactgtcagctggcccagccctcctctc
taccccctgtccccttcctgcggatatagacagcacttccctgcccccactgcagcccct
ggcgccccctaccccaggttcacccacccacccctgatgctaggctcgggtgtacctggt
caccacgctgccatcccccacccagccattgtgcccccttcagggaagcaggaactgcag
ccctatgaccgcagcctgaagacgcaggcagaatccaagggagagaaggaagccaagaag
ccaaccatcaagaagccactcaacgccttcatgctgtacatgaaggagatgagagccaag
gtcattgcagagtgcacgctcaaggagagtgctgctatcaaccagatactgggccgcagg
tggcacgcgctgtcgcgggaagagcaggccaagtattatgagctggcccgcaaggagagg
cagctgcacatgcagctatacccaggctggtcggcgcgggacaactatggcaagaagaag
aggcggtcaagggaaaagcatcaggattccaacacagaccctggctcgcctaagaaatgc
cgtgctcgctttggcctcaaccagcagacggattggtgtggtccgtgcaggaggaaaaag
aaatgcattcggtacttacccggagaaggccgctgccccagccccgttccttccgatgac
agtgctctaggctgccccaagtccccagccccccaggactcaccctcatacctcctgctg
ccccacttccccacagaactgctcgctagccctgcggagccagcgcctacatcaccaggt
ctctcagccgccctcagcctcccagccccctgggccccttcaggcctctcacagcgacct
gcagagtacacaggtacagcaaccgcaatcgcagagaaaggcagcctagcatgcacagga
cacacagcttcctccaggagcccactctctgagaagagacgacagagccccaaagcacgt
ggaaaccggccaggggccctgttaactctctctcagggtcccagccccagagagttcaga
ggctgcccaacttctgcctga

KEGG   Sus scrofa (pig): 100523899
Entry
100523899         CDS       T01009                                 

Gene name
TCF7L1
Definition
(RefSeq) LOW QUALITY PROTEIN: transcription factor 7-like 1
  KO
K04490  transcription factor 7-like 1
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04310  Wnt signaling pathway
ssc04390  Hippo signaling pathway
ssc04520  Adherens junction
ssc04916  Melanogenesis
ssc04934  Cushing syndrome
ssc05132  Salmonella infection
ssc05165  Human papillomavirus infection
ssc05167  Kaposi sarcoma-associated herpesvirus infection
ssc05200  Pathways in cancer
ssc05210  Colorectal cancer
ssc05213  Endometrial cancer
ssc05215  Prostate cancer
ssc05216  Thyroid cancer
ssc05217  Basal cell carcinoma
ssc05221  Acute myeloid leukemia
ssc05224  Breast cancer
ssc05225  Hepatocellular carcinoma
ssc05226  Gastric cancer
ssc05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100523899 (TCF7L1)
   04390 Hippo signaling pathway
    100523899 (TCF7L1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    100523899 (TCF7L1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100523899 (TCF7L1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100523899 (TCF7L1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100523899 (TCF7L1)
   05225 Hepatocellular carcinoma
    100523899 (TCF7L1)
   05226 Gastric cancer
    100523899 (TCF7L1)
   05216 Thyroid cancer
    100523899 (TCF7L1)
   05221 Acute myeloid leukemia
    100523899 (TCF7L1)
   05217 Basal cell carcinoma
    100523899 (TCF7L1)
   05215 Prostate cancer
    100523899 (TCF7L1)
   05213 Endometrial cancer
    100523899 (TCF7L1)
   05224 Breast cancer
    100523899 (TCF7L1)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100523899 (TCF7L1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100523899 (TCF7L1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100523899 (TCF7L1)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    100523899 (TCF7L1)
   05165 Human papillomavirus infection
    100523899 (TCF7L1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ssc03000]
    100523899 (TCF7L1)
Transcription factors [BR:ssc03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    100523899 (TCF7L1)
SSDB
Motif
Pfam: CTNNB1_binding HMG_box HMG_box_2 NINJA_B
Other DBs
NCBI-GeneID: 100523899
NCBI-ProteinID: XP_020942961
Ensembl: ENSSSCG00000008241
LinkDB
Position
3
AA seq 438 aa
MKWPLLDVPTSATVKDTRSPSPAHLSNKVPVVQHPHHMHPLTPLITYSNDHFSPGSPPTH
LSPEIDPKTGIPRPPHPSELPPYYPLSPGAVGQIPHPLGWLVPQQGQPMYSLPPGGFRHP
YPALAMNASMSSLVSSRFSPHMVAPAHPGLPTSGIPHPAIVSPIVKQEPAPPSLSPAVSA
KSPVTVKKEEEKKPHVKKPLNAFMLYMKEMRAKVVAECTLKESAAINQILGRKWHNLSRE
EQAKYYELARKERQLHSQLYPTWSARDNYGKKKKRKREKQLSQTQSQQQVPEAEGALASK
SKKPCVQYLPPXKPCDSPASSHGSMLDSPATPSAALASPAAPAATHSEQAQPLSLTTKPE
TRAQLALHSAAFLSAKAAATSSGQMGSQAPLLSRPLPLGSVPTALLTSPPSFPTTLRAHQ
ALPVLQAQPLSLVTKSAH
NT seq 1317 nt   +upstreamnt  +downstreamnt
atgaaatggcccctcctcgatgtccccaccagcgccacggtcaaggacaccaggtcacca
tccccagcacacttgtccaataaagttcctgttgttcagcacccacatcacatgcacccg
ttgacgcccctcatcacctacagcaacgaccacttctcccctggctcccctcccacacac
ctctccccggagatcgatccaaagacaggaatcccccggccccctcacccgtctgagctg
cctccgtattacccactctctcctggagctgtcgggcaaatcccccatcccctcggctgg
ctcgtcccacagcaaggacagcccatgtactcccttcctcccggcggcttccggcacccc
taccctgccctcgccatgaacgcctccatgtccagcctggtttccagtcggttctcccct
cacatggtggctccggcccatcctggtctgcccacctcagggatcccccaccccgccatc
gtctcccccatcgtcaagcaggaaccagcgccccccagcctgagcccggcagtgagcgcg
aaatcaccagtcacggtgaaaaaagaggaagaaaagaaaccccacgtgaagaagcctctt
aatgccttcatgttatatatgaaggagatgagggccaaggtggtggccgagtgcacccta
aaggaaagtgcagccatcaaccagatcctggggagaaagtggcacaacctctcgcgagaa
gagcaggccaagtactacgagctggcccggaaggagcggcagctgcactcgcagctctac
ccgacttggtccgcgcgggacaactacggtaagaaaaagaagaggaagcgggaaaagcag
ctatcgcagacacagtcccagcagcaagtcccagaggcagagggtgctctggcctccaaa
agcaagaagccatgtgtccagtacctgcccccgnagaagccctgtgacagccctgcctcc
tcccacggcagcatgctggactccccagccaccccttcggcggccttggcctctcctgca
gccccggccgccacccactccgagcaagcccagcccctctccctcaccaccaagccagag
acccgggcccagctggctctccactcagccgccttcctgtcagcaaaggctgccgccacc
tcctctggccagatgggcagccaggcccccctcctgtcccggcccctccccctggggtcc
gtgcccacagctctgctgacgtcccccccttctttcccaaccactctccgtgctcaccag
gccctcccggtgctccaagcccagcctctttccttggtcaccaagtctgcccactaa

DBGET integrated database retrieval system