KEGG   Sus scrofa (pig): 100153974
Entry
100153974         CDS       T01009                                 

Gene name
CTNNA3
Definition
(RefSeq) catenin alpha-3 isoform X7
  KO
K05691  catenin alpha
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04390  Hippo signaling pathway
ssc04520  Adherens junction
ssc04670  Leukocyte transendothelial migration
ssc05100  Bacterial invasion of epithelial cells
ssc05200  Pathways in cancer
ssc05213  Endometrial cancer
ssc05226  Gastric cancer
ssc05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    100153974 (CTNNA3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    100153974 (CTNNA3)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    100153974 (CTNNA3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100153974 (CTNNA3)
  09162 Cancer: specific types
   05226 Gastric cancer
    100153974 (CTNNA3)
   05213 Endometrial cancer
    100153974 (CTNNA3)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100153974 (CTNNA3)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    100153974 (CTNNA3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ssc04812]
    100153974 (CTNNA3)
Cytoskeleton proteins [BR:ssc04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     100153974 (CTNNA3)
SSDB
Motif
Pfam: Vinculin AAA_32
Other DBs
NCBI-GeneID: 100153974
NCBI-ProteinID: XP_005671093
LinkDB
Position
14
AA seq 714 aa
MSKKERSRINLLDLKSPNQRDEIAGARASLKENSPILHSICSAYLEHSDVASLKASKDTV
CEEIQNALNVISNASQGIQNMSPPPEPQAATLGSALDELENLIVLDPLTVTEEEIRPSLE
KRLEAIISGAALLADSSCTRDFHRERIIAECNAIRQALQDLLSEYMNNTGKKERSNTLNI
AIENMCKKTRDLRRQLRKAIIDHVSDSFLDTTVPLLVLIEAAKNGREKEIKEYAAIFREH
TSRLVEVANLACSMSTNEDGIKIVKVAANHLETLCPQIINAALALAARPKSQVVKKTMEM
YKRTWENHIHVLTEAVDDITSIDDFLAVSESHILEDVNKCIIALRDQDADNLDRAAGAIR
GRAARVAHIVTGEMDSYEPGAYTEGVMRNVNFLTSTAIPEFVTQVNVALEALSKNSLDVF
DDNQFVDISKKIYDTIHDIRCSVMMIRTPEELEDVSDLEEDHEVRSHTSVQTEGKTDRAK
MTQLPEAEKEKIAEQVADFKKVKSKLDAEIEIWDDTSNDIIVLAKRMCMIMMEMTDFTRG
KGPLKHTTDVIYAAKMISESGSRMDVLARQIANQCPDPSCKQDLLAYLEQIKFYSHQLKI
CSQVKAEIQNLGGELIMSALDSVTSLIQAAKNLMNAVVQTVKMSYIASTKIIRIQSPVGP
RHPVVMWRMKAPAKKPLIKREKPEETYAAVRRGSAKKKIHPVQVMSEFRGRHVY
NT seq 2145 nt   +upstreamnt  +downstreamnt
atgtcaaagaaagaaagatccaggattaatttattagacttaaaatctccaaatcagagg
gatgaaattgcaggtgcccgggcctctttgaaggagaactcccccatattgcattcaatt
tgttcagcttatttggaacattctgatgttgcttccctcaaagccagcaaggatacagtg
tgtgaagaaattcagaatgccctcaatgtgatttcaaatgcttcacaaggcatccagaat
atgtcacccccaccagaacctcaggcagcaaccctgggaagtgcccttgatgaacttgag
aatttaattgtcttggatccactcacagtgactgaagaggaaataagaccatccctagag
aaacgtcttgaggccattatcagtggggctgctctgctggctgactcttcatgcacgagg
gatttccatcgggagcgcattatcgcagaatgcaatgccattcgccaggctctccaggac
ctgctttcagagtacatgaacaatactggaaaaaaggaaagaagtaataccctgaatatc
gcaatagaaaacatgtgcaagaagacaagagaccttcgcagacagctccgtaaggctatt
atagatcacgtgtcagactcctttttggatacaacagtcccacttttggttctcattgaa
gctgccaagaatggccgggaaaaagaaataaaagaatatgctgcaatatttcgtgaacac
accagcaggcttgtagaggtggcaaaccttgcttgttccatgtccacaaatgaagatggg
attaaaattgtcaaagttgcagccaatcacctggaaaccttgtgtcctcagattattaat
gctgcccttgctttggctgcaaggcccaaaagtcaagtggtcaaaaaaaccatggaaatg
tacaagcgcacatgggagaatcatatccatgtcctcactgaagctgttgatgacattaca
agcattgatgacttccttgctgtgtctgagagccatatcctagaagatgtcaacaaatgt
atcatagccttgagagatcaggatgctgataatttagaccgcgctgcaggtgctatcaga
ggacgggcagcaagagttgctcatattgtcacaggggaaatggacagttatgagccaggg
gcttacacagaaggtgtgatgagaaatgtcaacttcctgacaagtactgcaattcctgaa
tttgtcacacaagtgaatgttgccttggaagccttaagtaaaaactctttggatgtgttt
gatgataatcaatttgtggacatctcaaagaagatctatgatacaattcacgacatcaga
tgttcggtcatgatgattcggactcctgaagaacttgaggatgtttctgacctggaagaa
gatcatgaagtccgcagtcacaccagtgttcagaccgaaggaaaaactgaccgggctaag
atgactcaattgcctgaggcagaaaaggaaaagattgctgagcaagttgctgatttcaag
aaagtaaagagtaagctggatgctgagattgagatatgggatgatacaagcaacgatatc
attgtcctggccaagaggatgtgtatgatcatgatggagatgacggatttcacaagggga
aaaggaccactaaagcatacaactgatgtgatctatgcagctaaaatgatatctgaatct
ggatcaagaatggacgtccttgctcggcagattgccaaccagtgcccagatccatcatgc
aaacaggacttattggcatacctggaacagattaagttctactctcatcaactgaaaata
tgcagtcaagttaaagctgagatacagaacctgggaggagagctcatcatgtcagcgttg
gatagtgtcacctccttgatccaagcagccaaaaatttaatgaatgctgtagtgcaaaca
gtgaaaatgtcctacattgcttcaaccaaaatcatccgaattcagagtcctgtggggccc
cggcacccagttgtgatgtggagaatgaaggctcctgcgaaaaaacccttgattaaaaga
gagaagccagaagaaacatatgctgctgtaaggcgaggctcagccaagaaaaaaatccac
cctgtgcaagtcatgagtgaatttagaggaagacatgtctactga

KEGG   Sus scrofa (pig): 100523778
Entry
100523778         CDS       T01009                                 

Gene name
CTNNA1
Definition
(RefSeq) catenin alpha-1
  KO
K05691  catenin alpha
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04390  Hippo signaling pathway
ssc04520  Adherens junction
ssc04670  Leukocyte transendothelial migration
ssc05100  Bacterial invasion of epithelial cells
ssc05200  Pathways in cancer
ssc05213  Endometrial cancer
ssc05226  Gastric cancer
ssc05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    100523778 (CTNNA1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    100523778 (CTNNA1)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    100523778 (CTNNA1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100523778 (CTNNA1)
  09162 Cancer: specific types
   05226 Gastric cancer
    100523778 (CTNNA1)
   05213 Endometrial cancer
    100523778 (CTNNA1)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100523778 (CTNNA1)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    100523778 (CTNNA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ssc04812]
    100523778 (CTNNA1)
Cytoskeleton proteins [BR:ssc04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     100523778 (CTNNA1)
SSDB
Motif
Pfam: Vinculin Peptidase_C5
Other DBs
NCBI-GeneID: 100523778
NCBI-ProteinID: XP_003124036
Ensembl: ENSSSCG00000014339
UniProt: A0A5G2R7Z4
LinkDB
Position
2
AA seq 906 aa
MTAVHTGNINFKWDPKSLEIRTLAVERLLEPLVTQVTTLVNTNSKGPSNKKRGRSKKAHV
LAASVEQATENFLEKGDKIAKESQFLKEELVAAVEDVRKQGDLMKSAAGEFADDPCSSVK
RGNMVRAARALLSAVTRLLILADMADVYKLLVQLKVVEDGILKLRNAGTEQDLGIQYKAL
KPEVDKLNIMAAKRQQELKDVGHRDQMAAARGILQKNVPILYTASQACLQHPDVAAYKAN
RDLIYKQLQQAVTGISNAAQATASDDASQHQGGGGGELAYALNNFDKQIIVDPLSFSEER
FRPSLEERLESIISGAALMADSSCTRDDRRERIVAECNAVRQALQDLLSEYMGNAGRKER
SDALNSAIDKMTKKTRDLRRQLRKAVMDHVSDSFLETNVPLLVLIEAAKNGNEKEVKEYA
QVFREHANKLIEVANLACSISNNEEGVKLVRMSASQLEALCPQVINAALALAAKPQSKLA
QENMDLFKEQWEKQVRVLTDAVDDITSIDDFLAVSENHILEDVNKCVIALQEKDVDGLDR
TAGAIRGRAARVIHVVTSEMDNYEPGVYTEKVLEATKLLSNTVMPRFTEQVEAAVEALSS
DPAQPMDENEFIDASRLVYDGIRDIRKAVLMIRTPEELDDSDFETEDFDVRSRTSVQTED
DQLIAGQSARAIMAQLPQEQKAKIAEQVASFQEEKSKLDAEVSKWDDSGNDIIVLAKQMC
MIMMEMTDFTRGKGPLKNTSDVISAAKKIAEAGSRMDKLGRTIADHCPDSACKQDLLAYL
QRIALYCHQLNICSKVKAEVQNLGGELVVSGVDSAMSLIQAAKNLMNAVVQTVKASYVAS
TKYQKSQGMASLNLPAVSWKMKAPEKKPLVKREKQDETQTKIKRASQKKHVNPVQALSEF
KAMDSI
NT seq 2721 nt   +upstreamnt  +downstreamnt
atgactgctgttcacacaggcaacataaacttcaaatgggatcccaagagcctagagatc
aggactctggcagttgaaagactgttggagcctcttgtcacccaggttacaactctggta
aacaccaatagtaagggaccctccaataagaagagaggtcgttctaagaaggctcatgtg
ttggctgcatctgttgaacaagcaactgagaatttcttggagaagggggataaaattgcg
aaggagagtcagtttctcaaggaggagcttgtggctgctgtggaagatgttcgaaaacaa
ggtgatttgatgaagagtgctgctggggagtttgcagatgatccctgctcttccgtgaag
cgtggcaacatggttcgggcagctcgagctttgctctctgctgttactcggctgcttatt
ttggctgacatggcagatgtctacaaattacttgttcagctgaaagtcgtagaagatggt
atcttgaaactgagaaacgctggcactgaacaagacctgggaatacagtataaagccctg
aaacccgaagtggataagctgaatattatggcagccaaaaggcagcaggaactgaaagat
gtggggcatcgtgatcagatggccgccgccagaggaatcctgcagaaaaacgtgccgatc
ctctacactgcatcccaggcgtgcctccagcaccctgacgtcgcagcctacaaggccaac
cgcgacctgatatacaaacagctgcagcaggcggtcacaggcatttctaacgcagcccag
gccacggcgtcagatgacgcctcccagcaccagggtggcggaggaggagagctggcgtac
gccctcaacaactttgataagcaaatcattgtggaccccttgagcttcagcgaggagcgc
tttcggccttcgctggaggagcgcctggaaagcatcattagcggggctgccctgatggct
gactcgtcctgcacacgtgacgaccggcgtgagagaattgtggccgagtgtaatgctgtc
cgccaggccttgcaggatctgctctccgagtacatgggcaatgctggacgtaaagaaaga
agtgatgccctcaattctgcaatagataaaatgaccaagaagactagagacctgcgcagg
cagctccgcaaagctgtcatggaccacgtttcagattcatttctggaaaccaacgttcca
cttttagtattgattgaagctgcaaagaatggaaatgagaaagaagttaaagaatatgcc
caagttttccgtgaacatgccaacaaattaattgaggttgccaacctggcctgttccatc
tcaaacaatgaagaaggtgtaaagcttgttcgaatgtctgcaagccagctagaagccctc
tgtcctcaggttatcaatgctgcattggccttagcagcaaaaccgcagagtaaactggcc
caggagaacatggatctttttaaagaacagtgggaaaaacaagtccgagttctcacggat
gccgttgatgacattacttccattgacgacttcttggcggtctcagagaatcacatcttg
gaagacgtgaacaagtgcgtcatcgctctccaggagaaagacgtggatggtctggaccgc
acagccggtgccattcgcggccgggccgcccgcgtcattcacgtagtcacctcggagatg
gacaactatgagccaggggtctacacagagaaggtgctggaagccaccaagctgctctcc
aacacagtcatgccacgttttaccgagcaagtagaagcggccgtggaagccctcagctcg
gacccggcccagcccatggatgagaacgagtttatcgacgcctcgcgcctggtgtacgat
ggcatccgcgacatcaggaaagcggtgctgatgatcaggacccctgaggagctggacgac
tcggacttcgagacggaagacttcgatgtccgcagcaggaccagtgtccagacagaggac
gaccagctgatcgccggccagagtgcccgggcgatcatggctcagcttccccaggagcaa
aaagcgaagatcgcggaacaggtggccagcttccaggaagaaaagagcaagctggacgcc
gaagtgtccaagtgggacgacagcggtaacgacatcatcgtgctggccaagcagatgtgc
atgatcatgatggagatgacggacttcacccgaggtaaaggaccgctcaaaaacacatcc
gacgtgatcagcgccgccaagaagattgccgaggcaggatcccggatggataagctcggc
cgtaccatcgcagaccactgcccggactcggcctgtaagcaggacctgctggcctacctg
cagcgcatcgccctctactgccaccagctcaacatctgcagcaaagtcaaggccgaggtg
cagaacctgggcggggagctggtcgtctccggggtggacagcgccatgtccctgatccag
gccgccaagaacctgatgaacgccgtggtgcagacggtgaaggcctcctacgtggcctcc
accaagtaccagaagtcccagggcatggcctccctcaacctccccgccgtgtcctggaag
atgaaggcgcctgagaagaagcccttggtgaagagagagaagcaggacgagacccagacc
aagattaagagggcctcgcagaagaagcacgtgaaccccgtgcaggccctcagcgagttc
aaagccatggacagcatctga

KEGG   Sus scrofa (pig): 100525337
Entry
100525337         CDS       T01009                                 

Gene name
CTNNA2
Definition
(RefSeq) catenin alpha-2 isoform X1
  KO
K05691  catenin alpha
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04390  Hippo signaling pathway
ssc04520  Adherens junction
ssc04670  Leukocyte transendothelial migration
ssc05100  Bacterial invasion of epithelial cells
ssc05200  Pathways in cancer
ssc05213  Endometrial cancer
ssc05226  Gastric cancer
ssc05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    100525337 (CTNNA2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    100525337 (CTNNA2)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    100525337 (CTNNA2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100525337 (CTNNA2)
  09162 Cancer: specific types
   05226 Gastric cancer
    100525337 (CTNNA2)
   05213 Endometrial cancer
    100525337 (CTNNA2)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100525337 (CTNNA2)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    100525337 (CTNNA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ssc04812]
    100525337 (CTNNA2)
Cytoskeleton proteins [BR:ssc04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     100525337 (CTNNA2)
SSDB
Motif
Pfam: Vinculin
Other DBs
NCBI-GeneID: 100525337
NCBI-ProteinID: XP_020943858
Ensembl: ENSSSCG00000008250
LinkDB
Position
3
AA seq 992 aa
MTSATSPIILKWDPKSLEIRTLTVERLLEPLVTQVTTLVNTSNKGPSGKKKGRSKKAHVL
AASVEQATQNFLEKGEQIAKESQDLKEELVAAVEDVRKQGETMRIASSEFADDPCSSVKR
GTMVRAARALLSAVTRLLILADMADVMRLLSHLKIVEEALEAVKNATNEQDLANRFKEFG
KEMVKLNYVAARRQQELKDPHCRDEMAAARGALKKNATMLYTASQAFLRHPDVAATRANR
DYVFKQVQEAIAGISNAAQATSPTDEAKGHTGIGELAAALNEFDNKIILDPMTFSEARFR
PSLEERLESIISGAALMADSSCTRDDRRERIVAECNAVRQALQDLLSEYMNNTGRKEKGD
PLNIAIDKMTKKTRDLRRQLRKAVMDHISDSFLETNVPLLVLIEAAKSGNEKEVKEYAQV
FREHANKLVEVANLACSISNNEEGVKLVRMAATQIDSLCPQVINAALTLAARPQSKVAQD
NMDVFKDQWEKQVRVLTEAVDDITSVDDFLSVSENHILEDVNKCVIALQEGDVDTLDRTA
GAIRGRAARVIHIINAEMENYEAGVYTEKVLEATKLLSETVMPRFAEQVEVAIEALSANV
PQPFEENEFIDASRLVYDGVRDIRKAVLMIRTPEELEDDSDFEQEDYDVRSRTSVQTEDD
QLIAGQSARAIMAQLPQEEKAKIAEQVEIFHQEKSKLDAEVAKWDDSGNDIIVLAKQMCM
IMMEMTDFTRGKGPLKNTSDVINAAKKIAEAGSRMDKLARAVADQCPDSACKQDLLAYLQ
RIALYCHQLNICSKVKAEVQNLGGELIVSGTGVQSTFTTFYEVDCDVIDGGRASQLSTHL
PTCAEGAPIGSGSSDSSMVYSQDSCIRLGEQRGSEDETGYPIFAAELDTIYLKMESVLDS
ATSLIQAAKNLMNAVVLTVKASYVASTKYQKVYGTAAVNSPVVSWKMKAPEKKPLVKREK
PEEFQTRVRRGSQKKHISPVQALSEFKAMDSF
NT seq 2979 nt   +upstreamnt  +downstreamnt
atgacttcagcaacttcacctatcattttaaaatgggaccccaaaagtttggaaatccgg
acactgacagtggaaaggcttttggagccactcgtcacacaggtgacgacccttgtcaac
acaagcaacaaaggcccatctggtaaaaagaaagggaggtcaaagaaagcccatgtactg
gctgcatctgtagagcaagccactcaaaacttcctggaaaagggtgaacagatcgctaag
gagagtcaagatctcaaagaagaattggtggctgctgtcgaggatgtacgcaaacaaggt
gagaccatgcgcattgcctcttcagagttcgctgatgacccatgctcctcggtgaagcgg
ggcaccatggtgcgggcggccagggctctgctgtcggctgtgacgcgcttgctcatcctg
gcagacatggcagatgtcatgagacttttatctcacctgaaaattgtggaggaggccctg
gaagctgtcaaaaatgccacaaatgagcaagaccttgcaaatcgctttaaagaatttgga
aaagagatggtgaaacttaactacgtcgctgcaagaagacaacaggagctgaaggaccct
cactgccgggacgagatggcagctgcacgaggggctctgaagaagaatgccaccatgctg
tacacggcctcccaagccttcctccgccacccagacgtcgccgccacaagagccaaccgg
gattacgtgttcaaacaagtccaggaggccatcgccggcatctccaatgctgctcaagct
acctcgcccaccgatgaagccaaaggccacacgggcatcggggagctggctgcggctctg
aatgagtttgataacaagatcatcctggaccccatgacattcagcgaggcccggttccgg
ccgtccctggaggagcgtctggagagcatcatcagtggcgcggcgctcatggccgactcc
tcgtgcacccgggatgacaggcgtgagcgcatcgtggccgagtgcaacgccgtgcgccag
gcgctgcaggacctgctcagcgaatacatgaacaacactggaaggaaagaaaaaggagat
cctctaaacatcgccattgataagatgaccaagaaaacaagagatctaaggagacagctt
cggaaagcagtaatggatcacatatctgattctttcttggaaaccaacgtccctttgctg
gttctcattgaggctgcaaaaagtgggaatgagaaggaagtgaaggaatatgcccaggtt
ttccgcgagcatgccaacaagctggtggaggttgccaatttggcctgttccatctccaac
aatgaggaaggggtgaaattagtccggatggcagccacccagattgacagcctgtgtccc
caggtcatcaatgccgctctcaccctggctgcccggccacaaagcaaagttgctcaggac
aatatggatgtcttcaaagaccagtgggaaaagcaggtgcgagtgctgacagaggctgtg
gatgacatcacctccgtggatgacttcctttctgtctcagagaatcatatcttggaggat
gtgaacaagtgtgtgatagcccttcaagagggggatgtggacactctggaccggacagca
ggggccatcaggggccgggcagctcgagtcatacacatcatcaatgctgagatggagaac
tatgaagctggtgtttataccgagaaggtgctggaagctacaaaattactctctgagaca
gtgatgccacgctttgctgagcaagtggaggttgccattgaagccttgagcgccaacgtc
cctcaaccatttgaggagaatgagttcatcgatgcctctcgcctggtgtatgacggcgtt
cgggacatcagaaaggctgtgctgatgatcaggaccccagaagaactagaagatgattca
gactttgagcaggaagattacgatgtacgtagccggacaagtgttcagacagaggatgac
cagctcattgcagggcagagtgctcgggccatcatggcacaactaccacaggaggagaag
gcaaaaatagctgagcaggtggagatattccaccaagagaaaagcaagctggatgctgaa
gtggccaaatgggatgacagcggcaatgacatcattgtgctggccaagcagatgtgtatg
atcatgatggaaatgacggacttcacaagaggcaaaggaccattgaaaaatacatctgat
gtcattaatgctgccaagaaaattgctgaagcaggttctcgaatggacaaattagcccgt
gccgtggctgatcagtgtcctgattcagcatgtaagcaggatttattagcctaccttcaa
cggattgccttgtattgccatcagcttaatatctgcagcaaggtgaaggcagaagttcag
aatctgggaggagagctcattgtgtcagggacaggagttcagagcactttcactaccttt
tatgaggtagattgtgatgtcatagatgggggcagggctagtcaactttctacccacctc
ccaacctgtgctgagggagctccgatcgggagtggaagcagtgattcctctatggtttat
tcacaggattcctgcatcaggctgggagagcaaaggggttctgaagacgaaacaggctat
cctatttttgcagcagaattagacaccatctatctgaaaatggaatctgtgctggacagt
gccacatcactcatccaggcagctaaaaacctgatgaatgctgttgtcctcacagtgaaa
gcatcctatgtggcctcaacaaagtatcagaaggtctatgggacagcagctgtcaactca
cctgttgtgtcttggaagatgaaggctccagaaaagaagccccttgtgaagagagaaaaa
cctgaagaattccagacacgagttagacgaggttctcagaagaaacacatttcgcctgta
caggctttaagtgaattcaaagcaatggattccttctag

DBGET integrated database retrieval system