KEGG   Sus scrofa (pig): 100154319Help
Entry
100154319         CDS       T01009                                 

Gene name
SOD2
Definition
(RefSeq) superoxide dismutase [Mn], mitochondrial
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04068  FoxO signaling pathway
ssc04146  Peroxisome
ssc04211  Longevity regulating pathway
ssc04213  Longevity regulating pathway - multiple species
ssc05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100154319 (SOD2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    100154319 (SOD2)
 09150 Organismal Systems
  09149 Aging
   04211 Longevity regulating pathway
    100154319 (SOD2)
   04213 Longevity regulating pathway - multiple species
    100154319 (SOD2)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05016 Huntington disease
    100154319 (SOD2)
Enzymes [BR:ssc01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     100154319 (SOD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-GeneID: 100154319
NCBI-ProteinID: NP_999292
Ensembl: ENSSSCG00000029876
Vega: OTTSUSG00000001720
LinkDB All DBs
Position
1
AA seq 222 aa AA seqDB search
MLCRAACSSSRNLVPALGVLGSRQKHTLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVN
NLNVVEEKYQEALKKGDVTAQVALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEA
IKRDFGSFEKFKEKLTAVSVGVQGSGWGWLGFNKEQGRLQIAACSNQDPLQGTTGLVPLL
GIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYAACKK
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgttgtgcagggcggcgtgcagctcgagcaggaatctggtgccggctttgggggtcctg
ggttcccggcagaagcacaccctccccgacctgccgtacgactatggcgccctggagccg
cacatcaacgcccagatcatgcagctgcaccacagcaagcaccacgcggcctacgtgaac
aacctgaacgtcgtggaggagaagtaccaggaggcgctgaaaaagggtgatgttacagct
caggtagctctgcagcctgcattgaagttcaacggtggaggccacatcaatcatagcatt
ttctggacaaatctgagccctaacggtggcggggaacccaaaggggaattgctggaagcc
atcaaacgcgactttggttccttcgaaaaattcaaggagaagttgaccgctgtatccgtc
ggcgtccaaggctcaggctggggttggctcggtttcaacaaggaacagggccgcttgcag
attgccgcttgttctaaccaggatcccctgcaaggaacaacaggtctggttccgctgctg
gggatcgacgtgtgggagcatgcgtattaccttcagtataaaaacgtcagacctgattac
ctgaaagctatttggaatgtaatcaactgggagaatgtaactgagcgatacgccgcttgc
aaaaagtaa

DBGET integrated database retrieval system