KEGG   Sus scrofa (pig): 100154511Help
Entry
100154511         CDS       T01009                                 

Gene name
HIST1H3E
Definition
(RefSeq) histone H3.1
  KO
K11253  histone H3
Organism
ssc  Sus scrofa (pig)
Pathway
ssc05034  Alcoholism
ssc05202  Transcriptional misregulation in cancer
ssc05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    100154511 (HIST1H3E)
  Immune diseases
   05322 Systemic lupus erythematosus
    100154511 (HIST1H3E)
  Substance dependence
   05034 Alcoholism
    100154511 (HIST1H3E)
Chromosome and associated proteins [BR:ssc03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    100154511 (HIST1H3E)
Exosome [BR:ssc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100154511 (HIST1H3E)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CENP-S CENP-T_C CBFD_NFYB_HMF PAF TFIID-31kDa
Motif
Other DBs
NCBI-GeneID: 100154511
NCBI-ProteinID: NP_001274345
Ensembl: ENSSSCG00000024918
UniProt: F1RVA0
LinkDB All DBs
Position
7
AA seq 136 aa AA seqDB search
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI
MPKDIQLARRIRGERA
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atggctcgtaccaagcagaccgctcgcaagtccaccggcggcaaggcgccgcgcaagcag
ctggccaccaaggcggcccgcaagagcgcgcccgccaccggcggcgtgaagaagccgcac
cgctaccggcccggcacggtggccctgcgcgagatccggcgctaccagaagtccacggag
ctgctgatccgcaagctgccgttccagcggctggtgcgcgagatcgcgcaggacttcaag
acggacctgcgcttccagagctcggccgtgatggcgctgcaggaggcgtgcgaggcctac
ctggtggggctcttcgaggacaccaacctgtgcgccatccacgccaagcgcgtcaccatc
atgcccaaggacatccagctggctcgccgcatccgcggggagagggcgtaa

DBGET integrated database retrieval system