KEGG   Sus scrofa (pig): 100154609
Entry
100154609         CDS       T01009                                 

Gene name
PER2
Definition
(RefSeq) period circadian protein homolog 2 isoform X1
  KO
K02633  period circadian protein 2
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04710  Circadian rhythm
ssc04713  Circadian entrainment
ssc05202  Transcriptional misregulation in cancer
ssc05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    100154609 (PER2)
   04713 Circadian entrainment
    100154609 (PER2)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    100154609 (PER2)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    100154609 (PER2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ssc03400]
    100154609 (PER2)
DNA repair and recombination proteins [BR:ssc03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    100154609 (PER2)
SSDB
Motif
Pfam: Period_C PAS_3 PAS_11 PAS
Other DBs
NCBI-GeneID: 100154609
NCBI-ProteinID: XP_020930546
Ensembl: ENSSSCG00000016338 ENSSSCG00000023854
LinkDB
Position
15
AA seq 1290 aa
MLLGVLWQPSPGKDPGVGGGPLRKGQALSGSSMNGYADYAPSPGDPSKEHVEPGPRQVPL
QEDVDMSGGSSGNETNENGSPGRDSQGSDCDDSGKELRTLAGPPGAHQGPDAFSLMMAKS
EHNPSTSGCSSEPSTKADAHKELIKTLRELKVHLPAEKKAKGKASTLATLKYALRSVKQV
KANEEYYQLLMASEKQPCSAHVPAYTVEELESATSEFVVKNPEMFAAAVSLVTGKILYIS
DQVASIFHCKRDTFYDAKFVEFLAPHDVSVFHSSTSPYKLPPWSLCRGADSFTRECMEEK
SFFCRVSVGKNHESEIRYHPFRMTPYLVQVRDPQGAEDQLCCVLLAERVHSGYEAPRIPP
EKRIFTTTHSPNCLFQDVDERAVPLLGHLPQDLIETPVLVQLHPSDRPLMLAIHKKIVQS
GGQPFDYSPIRFRARNGEYVTLDTSWSSFVNPWSRKVSFIIGRHRVRVGPLNEDVFSAQP
CMEEKALQSGVQEFTEQIRRLLLQPVPHSGSSGYGSLGSNGSHEHLMSQTSSSDSTGQED
PCRRRVEICKNDNKVKNESHYPGASGQQESQSAAATQSSSLAHVSTVPAAEKDSSGASLP
EELACKNPPAGSYQQISCLDGVIRYLESCSEAATLKRKCEFPAHLPTPKASDKRKATASP
GPHSAETASASKMNSRADVSTHLTSLTLPGKAESVVSLTSQCSYSSTIVHVGDKKPQPEL
ETVEDATSGPESLDCLAGPALPCSLGQDPEPFRKLGLTKEVLAAHTQKEEQSFLLKFKEI
RKLNIFQSPCHHYLQERSRAQPSERAAPGLRNPSGVDSSWKKNGKNRKLKSKRVKPRDSS
GSTGSGGPVPQRPPLLGLNATAWSPSDTSQSSCPSMPFPAPVPAYSLPVFPVPGTVAAAP
HAGFAVPVDTQHEFAVQPPAFAGPLAPVLALVVPSYPFSSVASNLPQTFFPGQPSFPSQV
TPASQSEFPGQTSFPKQPHACPRAEHGPPASRVATPATLPSAAGPAGRTSPPLFQSRGSS
PLQLNLLQLEETPEGSASATGAAGAGPDCKPGSAWDRQPKALTTGEEPADAQNSDALSAS
SGLLHLLLHADVCSAAGSALSGSGASATSCSLGSGSQGCDASPSGTGSSDTGHSSKYFGS
IDSSEKNHKAKVKADRAENERFIKSVLQEPVWLLAADSDDRVMMTYQMPARNVDTVLRED
REKLRALRGLQPRFTDGQRQELQDVHPWMRSGGLPAALDVPECVYCGNEGKGGIGVPSEE
HLPAPGLSEVADTKEEGSGPPLSHRNREQT
NT seq 3873 nt   +upstreamnt  +downstreamnt
atgcttctgggtgtactttggcagccaagtcctggaaaggacccaggggtgggtggcggc
ccgctccggaaaggccaagctttgtccgggagcagcatgaacgggtacgctgactatgcc
cccagccccggtgacccctccaaggagcacgtggagcctgggccccgccaggtgcccctc
caggaggacgtggacatgagcggtggctccagcggaaatgaaaccaacgagaacggctcg
ccagggcgggactcgcagggcagcgactgtgacgacagcggcaaggagctgaggacgctg
gctgggccacctggcgctcaccagggtccagatgcctttagcctgatgatggcgaagtcc
gaacacaatccgtccacaagtggctgcagcagcgagccgtccaccaaagcggacgcccac
aaagagctgatcaaaacgctgagggagctgaaagtccacctgcccgcagagaagaaggcc
aaggggaaggccagcaccttggcgaccctgaagtacgccctgaggagcgtgaagcaggtg
aaagccaacgaggagtattaccagctgctgatggccagcgagaagcagccctgcagcgcc
cacgtgcccgcctacaccgtggaggagctcgagagcgccacctccgagttcgtcgtgaag
aacccggaaatgtttgccgcggctgtgtccctggttactgggaaaatcctgtacatctct
gaccaagttgcctccatctttcactgtaagagggacaccttttacgacgccaagttcgtg
gagttcttggcgccccacgacgtgagcgtcttccacagctccacctcgccttacaagctg
ccgccctggagcctctgccgcggagcagattcttttactcgagaatgcatggaagagaag
tctttcttttgccgggtcagcgttgggaaaaaccacgagagcgagatccgctaccacccg
ttccgcatgacgccctacctggtccaggtgcgcgacccgcagggcgccgaggaccagctg
tgctgtgtgctgctggcggagagggtgcactcgggctatgaagcccctagaatccctcct
gaaaagagaatcttcacgacgacacattcaccgaattgcttgttccaggatgtggacgaa
agggcggtccccctcctgggccacctgccccaggacctgattgagacccccgtgctggtg
cagctgcaccccagcgacaggccgctgatgctcgccatccacaaaaagatcgtgcagtcc
ggcgggcagcctttcgactactcccccatccgcttccgcgcgcggaacggggagtacgtc
acgctggacaccagctggtccagcttcgtcaacccgtggagcaggaaggtctccttcatc
atcgggaggcacagagtcagggtggggcccctgaatgaggacgtgttctcggctcagccg
tgcatggaggagaaggcgctgcagtccggcgtccaggagttcacggagcagatccgccgg
ctgctgctgcagcccgtcccccacagcggctccagcggctacggcagcctgggcagcaac
ggctcccacgagcacctcatgagccagacctcctccagcgacagcaccggccaggaggac
ccctgccggaggagagtcgaaatttgtaaaaatgataacaaggtcaaaaacgagagccat
taccctggtgcatctggacaacaagagagccagtctgctgcagcgacacagagcagctcc
ctggcgcacgtgagcactgtcccggctgcggaaaaagacagctcgggggccagcctgccc
gaggagttggcctgcaagaacccgcccgccggctcctaccagcagatcagctgcctggac
ggagtcatcaggtacctggagagctgcagcgaggccgccaccctgaagaggaagtgcgag
ttccccgcgcacctccccacgcccaaggccagcgacaagcgcaaggccacggccagcccg
gggccgcattccgcagagacagcatcggcctctaagatgaacagccgtgcggacgttagc
acgcacttgacctcgctgacgctgcccggcaaggcggagagtgtggtgtccctgaccagc
cagtgcagctacagcagcaccatcgttcacgtgggcgacaagaagccacagcctgagctt
gagacggtggaagatgccacaagtgggcctgagtctctggattgcctggcgggccctgcc
ctgccctgcagcctcggccaggaccccgagcccttcaggaagctgggcctcaccaaggaa
gtgctggctgcccacacccagaaggaggagcagagcttcctgctgaagttcaaagaaata
aggaaactcaatattttccagtctccctgccaccattacttacaagaaaggtccagggcg
cagccgagtgaaagagctgctcctggactaagaaatccctccggggtggactcatcttgg
aaaaaaaacgggaagaacagaaaactgaagtccaaacgggtcaagcctcgtgactcctcg
ggaagcactgggtctggggggccggtgccccagaggcccccgctgctgggtctgaatgcc
acagcctggtcaccatcggacacgtctcagtccagctgtccctcaatgcccttccctgcc
ccggtgccagcttactccctgcccgtgtttccagtcccaggaaccgtggcagcagcaccc
cacgccggcttcgcggtgcccgtggacacccagcacgagtttgcggtccagcccccggca
ttcgccggccccttggccccagtcctggcgctggtggtccccagctaccccttctcctca
gtggcctcgaacctgccccagaccttcttccccggccagcctagctttccatcccaggtg
actcctgcctcacagtctgagttccctggtcagacctcattccccaaacagccacatgca
tgtcctcgggcagagcatgggccaccagcgtcacgtgtagccaccccggccaccctgcca
tcagccgctgggcccgcaggcaggacctccccgccgctcttccagtcccgcggaagctcg
cccctgcagctcaacctgctgcagctggaggagacccccgagggcagcgcctcggccacg
ggggcggcaggtgcggggccagactgcaagcctggctcggcctgggaccggcagccgaag
gcactgacgaccggcgaggagccagccgacgcccagaacagcgacgccctctcagcgtcc
agcggcctgctccacctcctgctgcacgcggacgtctgctctgccgcgggctcggcgctc
tctggaagcggggcctccgccacctcctgttccctgggctcaggctcacagggctgcgac
gcatccccaagtgggacaggcagcagcgacacaggtcacagcagcaaatattttggaagc
attgactcttcagagaaaaaccacaaagcgaaagtgaaggcggacagggcggaaaatgag
cgcttcatcaagagcgtcctgcaggagcccgtctggctgctggcggccgactccgacgac
cgtgtcatgatgacctaccagatgccagcccgaaacgtggacacggttctgcgggaggac
agggagaagctgagggcgctgcgggggctccagcccaggttcacggacgggcagagacag
gagctgcaggacgtccacccgtggatgcggtcaggcggcctgcccgccgccctcgacgtg
ccggaatgtgtttactgtggaaacgaggggaaaggcggcattggtgtgccatctgaggaa
cacctccctgctccggggctcagcgaagtggcggacaccaaggaggagggaagcggaccc
cccctgagtcacagaaaccgggagcagacgtag

DBGET integrated database retrieval system