KEGG   Sus scrofa (pig): 100154715
Entry
100154715         CDS       T01009                                 

Gene name
CDK2
Definition
(RefSeq) cyclin-dependent kinase 2
  KO
K02206  cyclin-dependent kinase 2 [EC:2.7.11.22]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04068  FoxO signaling pathway
ssc04110  Cell cycle
ssc04114  Oocyte meiosis
ssc04115  p53 signaling pathway
ssc04151  PI3K-Akt signaling pathway
ssc04218  Cellular senescence
ssc04914  Progesterone-mediated oocyte maturation
ssc04934  Cushing syndrome
ssc05160  Hepatitis C
ssc05161  Hepatitis B
ssc05162  Measles
ssc05165  Human papillomavirus infection
ssc05166  Human T-cell leukemia virus 1 infection
ssc05169  Epstein-Barr virus infection
ssc05200  Pathways in cancer
ssc05203  Viral carcinogenesis
ssc05215  Prostate cancer
ssc05222  Small cell lung cancer
ssc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100154715 (CDK2)
   04151 PI3K-Akt signaling pathway
    100154715 (CDK2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100154715 (CDK2)
   04114 Oocyte meiosis
    100154715 (CDK2)
   04115 p53 signaling pathway
    100154715 (CDK2)
   04218 Cellular senescence
    100154715 (CDK2)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100154715 (CDK2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100154715 (CDK2)
   05203 Viral carcinogenesis
    100154715 (CDK2)
  09162 Cancer: specific types
   05226 Gastric cancer
    100154715 (CDK2)
   05215 Prostate cancer
    100154715 (CDK2)
   05222 Small cell lung cancer
    100154715 (CDK2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100154715 (CDK2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100154715 (CDK2)
   05161 Hepatitis B
    100154715 (CDK2)
   05160 Hepatitis C
    100154715 (CDK2)
   05162 Measles
    100154715 (CDK2)
   05169 Epstein-Barr virus infection
    100154715 (CDK2)
   05165 Human papillomavirus infection
    100154715 (CDK2)
Enzymes [BR:ssc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     100154715 (CDK2)
Protein kinases [BR:ssc01001]
 Serine/threonine kinases: CMGC group
  CDK family
   100154715 (CDK2)
DNA replication proteins [BR:ssc03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    100154715 (CDK2)
Chromosome and associated proteins [BR:ssc03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    100154715 (CDK2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Haspin_kinase Kinase-like
Other DBs
NCBI-GeneID: 100154715
NCBI-ProteinID: NP_001272394
Ensembl: ENSSSCG00000000373
UniProt: U3M3E7 A0A4X1W9I0
LinkDB
Position
5
AA seq 298 aa
MENFQKVEKIGEGTYGVVYKAKNKVTGEVVALKKIRLDTETEGVPSTAIREISLLKELNH
PNIVKLLDVIHTENKLYLVFEFLHQDLKKFMDASALTGIPLPLIKSYLFQLLQGLAFCHS
HRVLHRDLKPQNLLINAEGSIKLADFGLARAFGVPVRTYTHEVVTLWYRAPEILLGCKYY
STAVDIWSLGCIFAEMVTRRALFPGDSEIDQLFRIFRTLGTPDEVVWPGVTSMPDYKPSF
PKWARQDFSKVVPPLDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL
NT seq 897 nt   +upstreamnt  +downstreamnt
atggagaacttccaaaaagtggaaaagatcggagagggcacgtacggagttgtgtacaaa
gccaaaaacaaggtgacgggagaagtggtggcgcttaaaaaaatccgcctggacactgag
acggagggtgtacccagtactgccattcgagagatctctctgcttaaggagcttaaccac
cctaatattgtcaagttgctggatgtcattcacacagaaaacaaactctacctggttttt
gagtttctgcaccaggatctcaagaaattcatggatgcctctgctctcactggcattcct
cttcccctcataaagagttatctgttccagctgcttcaggggctagctttttgccattct
catcgggtcttgcaccgagaccttaaacctcagaatctgcttatcaacgcagaaggatct
atcaagttagcagactttggactggccagagcctttggagtccctgttcgtacatacacc
catgaggtggtgactttgtggtacagagcacctgaaatccttctgggctgcaaatactac
tctacagccgtggacatctggagcctgggctgcatctttgctgagatggtgacccgccgg
gctctgttccctggagattctgagattgaccagctcttccggatctttcggactctcggg
accccagatgaggtggtttggccaggagttacttccatgcctgattataaaccgagtttc
cctaagtgggccaggcaagattttagcaaagttgtgcctcccctggatgaagatggacgg
agcttgttatcgcaaatgctgcactacgaccccaacaagcggatttcagcaaaggcagct
ctggctcaccctttcttccaggatgtgaccaagccagtacctcaccttcgactttga

DBGET integrated database retrieval system