KEGG   Sus scrofa (pig): 100155053Help
Entry
100155053         CDS       T01009                                 

Gene name
RET
Definition
(RefSeq) LOW QUALITY PROTEIN: proto-oncogene tyrosine-protein kinase receptor Ret
  KO
K05126  proto-oncogene tyrosine-protein kinase Ret [EC:2.7.10.1]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc05200  Pathways in cancer
ssc05216  Thyroid cancer
ssc05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100155053 (RET)
   05230 Central carbon metabolism in cancer
    100155053 (RET)
  09162 Cancer: specific types
   05216 Thyroid cancer
    100155053 (RET)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ssc01001]
    100155053 (RET)
Enzymes [BR:ssc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100155053 (RET)
Protein kinases [BR:ssc01001]
 Receptor tyrosine kinases (RTK)
  RET family
   100155053 (RET)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr RET_CLD1 RET_CLD3 RET_CLD4 Pkinase Cadherin Pkinase_fungal RIO1 Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 100155053
NCBI-ProteinID: XP_020928491
Ensembl: ENSSSCG00000010199
LinkDB All DBs
Position
14
AA seq 1113 aa AA seqDB search
MAKATVGAVGLRLLLLLPLLGEAPLGLYFSRDAYWEKLYVDQPAGMPLLYVHALQDVPGE
VPSFRLGQHLYGVYRTRLHENDWIRIQEDTGLLYLNQSLDHSSWEKLSIRNGGFPLLTVY
LQVFLSPASLRESECQWPGCARVYFSFINASFPACGALKPRDLCFPRQAXSFRIRENRPP
GTFHQFRLLPVQFLCPNVSVAYSLLGGESQPFRCAADSLEVSTRWALDREQREKYELVAA
CTVRVGAREEEVMVPFPVTVYDEDDCAPTFLGGIDTASAVVEFKRKEGTVVATLRVFDAD
VVPASGELLRRYTNTLLSRDTWALQTFRVEHLPNETLAQVNGSFVRATIHDYRLVLNRSL
SILENRAVQLAVLVNDSDFQGPGEGVLLLHFNVSVLPVSLHLPSAYSFAVSRRAHRFAQI
GKVCVENCQEFSGIHVQYKLQLSNANCSALGXVTSAEDTTGTLFVNDTEALQRSECAQLE
YKVVAVDRLTRRQTQASLLVTVEGTYVAEEPGCPLSCAVSKRQPECEECGGLGSLNGRCE
WRQGDGKGITRNFSTCSPSIKTCPDGHCDAVESKDAHICPQDCLRGGSIIGGHEPGERRG
IKAGFGICNCFPEEKKCFCEPEDNQDPLCDELCRTVIAAAVLFSFIVSVLLSTFCIHRYH
KNAHKPPIASAEMTFRRPAQAFPVSYSSSGARRPSLDSMENPVSVDAFKIPEDPKWEFPR
KNLVLGKTLGEGEFGKVVKATAFRLKGKAGYTTVAVKMLKENASPSELRDLLSEFNLLKQ
VNHPQVIKLYGACSQDGPLLLIVEYAKYGSLRGFLRESRKAGPGYVGSGGSRHSSYLDNP
EERALTMGDLISFAWQISRGMQYLAEMKLVHRDLAARNVLVAEGRRMKISDFGLSRDVYE
EDSYVKRSKGRIPVKWMAIESLFDHIYTTQSDVWSFGVLLWEIVTLGGNPYPGIPPERLF
NLLKTGYRMERPDNCSEEMYSLMLQCWKQEPDKRPVFADISKDLDKMMVKSRDYLDLAAS
TPSDSLLYDDGLSEEETPLVDCNNAPLPRTLPSTWIENKLYGMSDPNWPEESPVPLTRAD
GTNTGCPRYANDSVYANWMVSPSAAQLMDAFDS
NT seq 3342 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaggcgacggtcggtgccgtggggctgcggttgttgctgctgctgccgctactc
ggcgaagccccgctgggactctacttctcaagggatgcctactgggagaagctgtacgtg
gaccagccggcaggcatgcctctgctctacgtccacgccctgcaggatgtccccggggag
gtgcccagcttccgcctgggccagcacctctatggtgtctaccgcacacggctgcacgag
aatgactggatccgcatccaggaggacacggggcttctctaccttaaccagagcctggac
cacagctcctgggagaagctcagcatccgaaacggcggcttccccctgctcaccgtttac
ctccaagttttcctgtcacctgcgtcccttcgagagagcgagtgccagtggccaggctgt
gcccgagtgtacttctccttcatcaatgcttccttcccggcttgtggagccctcaaaccc
cgggatctctgcttcccgaggcaagccntgtccttccgcattcgggagaataggcctcct
ggaaccttccaccaattccgcctgctgcctgtacagttcctctgccccaacgtcagtgta
gcctacagcctcctgggaggtgagagtcagcccttccgctgcgccgccgacagcctggag
gtgagcacgcgctgggccctggaccgtgagcagcgggagaagtatgagctggtggccgcg
tgcactgtgcgtgtgggcgcacgcgaggaggaggtgatggtgcccttccccgtgacggtg
tacgacgaggacgactgtgcgcccaccttcctcgggggcatcgacactgccagcgcagtg
gtggagttcaagcggaaggagggcactgtggtggccacgctgcgtgtcttcgatgcagat
gtggtgccagcatctggggagctcctgcgccggtacacgaacacactgctctccagggac
acctgggccctccagaccttccgagtagagcacttgcccaacgagaccttggcccaggtc
aacggcagctttgtgcgggccaccatacatgactacaggctggttctcaaccggagcctc
tccatcttggagaaccgggcggtgcagctggccgtgctggtcaacgactcagacttccag
ggccccggagagggagtcctcctcctccacttcaatgtgtccgtgctgcccgtcagcctg
cacctgcccagcgcctactcctttgctgtgagcaggcgggcccaccgctttgcccagatt
gggaaagtctgcgtggaaaactgccaggagttcagtggcatccatgtgcagtacaagctg
cagctctccaacgccaactgcagtgccctgggantagtcacctcggctgaggacaccacg
gggaccctgttcgtgaatgacacggaggcgctgcagcggtccgagtgtgcccagctcgag
tacaaggtggtggctgtcgaccggctgacccgcaggcaaacccaggcctcactgcttgtc
accgtggaggggacatatgtggctgaggagccaggctgccccctgtcctgcgcggtcagc
aagaggcagcccgagtgtgaggagtgtggcggcctgggctctctgaatggcaggtgcgag
tggagacagggagacggcaaaggaatcaccaggaacttctccacctgctcccccagcatc
aagacctgccctgacggccactgtgatgccgtggagagcaaagatgcccacatctgcccc
caggactgcctccggggcggcagcatcatcggtgggcacgagccaggggagcgccggggg
attaaagctggcttcggtatctgcaactgcttccctgaggagaagaagtgcttctgtgag
ccggaagataaccaggacccgctgtgtgatgagctctgccgcacagtcattgcggctgct
gtgctcttctccttcattgtatccgtgctgctatccaccttctgcatccaccgctaccac
aagaacgcccacaagccgcccattgcctcggctgagatgaccttccgccggcctgcccag
gccttcccggtcagctactcctcatctggtgcccgccggccctcgctggactccatggag
aacccggtctctgtggacgccttcaagatcccagaggatccaaagtgggaattccctcgg
aagaacttggttcttggaaaaaccctgggagaaggtgaatttggaaaagtggtcaaggcg
acagccttccggctgaagggaaaagcagggtacacaactgtggccgtgaagatgctgaaa
gagaacgcctccccaagcgagctgcgggacctgctgtcagagttcaacctgctaaagcag
gtcaaccacccgcaagtcatcaagctgtacggggcctgcagccaagatgggccactcctt
ctcatcgtggagtacgccaagtacggctccctgcggggcttcctccgagagagccgcaag
gcggggcctggctatgtgggcagcggaggcagccgccactccagctacctggacaacccc
gaggagcgggccctgaccatgggcgacctcatctcctttgcgtggcagatttcgcggggc
atgcagtacctggctgagatgaagctcgtccatcgagacttggcggccagaaatgtcctg
gtagccgaggggcgcaggatgaagatctcagacttcggtctgtcccgagatgtttatgaa
gaggattcctatgtgaagaggagcaagggtcggatcccggtcaaatggatggccattgag
tcccttttcgatcacatctacaccacccagagtgatgtgtggtcctttggggtcctgctg
tgggagattgtgaccctggggggcaacccctaccctggcattcctccagagcggctcttc
aaccttctgaagacaggctacaggatggagaggccagacaactgcagcgaggagatgtac
agtctgatgctacagtgctggaagcaggaaccggacaagaggccagtgtttgctgacatc
agcaaagacctggataagatgatggttaagagcagagactacttggacctggctgcgtcc
accccatctgactccctgctatatgacgacggcctctcggaggaggagacgcccctggtg
gactgtaataatgctcccctccctcgaacccttccctccacgtggattgaaaacaaactc
tatggcatgtcagacccgaactggcctgaagagagtcctgtaccactcacgagagccgat
ggcactaacactggttgcccgagatatgcaaatgatagtgtatatgctaactggatggtt
tcaccctcagcggcacaattaatggacgcatttgatagttaa

DBGET integrated database retrieval system