KEGG   Sus scrofa (pig): 100155053
Entry
100155053         CDS       T01009                                 

Gene name
RET
Definition
(RefSeq) LOW QUALITY PROTEIN: proto-oncogene tyrosine-protein kinase receptor Ret
  KO
K05126  proto-oncogene tyrosine-protein kinase Ret [EC:2.7.10.1]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04020  Calcium signaling pathway
ssc05200  Pathways in cancer
ssc05216  Thyroid cancer
ssc05223  Non-small cell lung cancer
ssc05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100155053 (RET)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100155053 (RET)
   05230 Central carbon metabolism in cancer
    100155053 (RET)
  09162 Cancer: specific types
   05216 Thyroid cancer
    100155053 (RET)
   05223 Non-small cell lung cancer
    100155053 (RET)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ssc01001]
    100155053 (RET)
Enzymes [BR:ssc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100155053 (RET)
Protein kinases [BR:ssc01001]
 Receptor tyrosine kinases (RTK)
  RET family
   100155053 (RET)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr RET_CLD1 RET_CLD3 RET_CLD4 Pkinase Cadherin Pkinase_fungal RIO1
Other DBs
NCBI-GeneID: 100155053
NCBI-ProteinID: XP_020928491
Ensembl: ENSSSCG00000010199
LinkDB
Position
14
AA seq 1113 aa
MAKATVGAVGLRLLLLLPLLGEAPLGLYFSRDAYWEKLYVDQPAGMPLLYVHALQDVPGE
VPSFRLGQHLYGVYRTRLHENDWIRIQEDTGLLYLNQSLDHSSWEKLSIRNGGFPLLTVY
LQVFLSPASLRESECQWPGCARVYFSFINASFPACGALKPRDLCFPRQAXSFRIRENRPP
GTFHQFRLLPVQFLCPNVSVAYSLLGGESQPFRCAADSLEVSTRWALDREQREKYELVAA
CTVRVGAREEEVMVPFPVTVYDEDDCAPTFLGGIDTASAVVEFKRKEGTVVATLRVFDAD
VVPASGELLRRYTNTLLSRDTWALQTFRVEHLPNETLAQVNGSFVRATIHDYRLVLNRSL
SILENRAVQLAVLVNDSDFQGPGEGVLLLHFNVSVLPVSLHLPSAYSFAVSRRAHRFAQI
GKVCVENCQEFSGIHVQYKLQLSNANCSALGXVTSAEDTTGTLFVNDTEALQRSECAQLE
YKVVAVDRLTRRQTQASLLVTVEGTYVAEEPGCPLSCAVSKRQPECEECGGLGSLNGRCE
WRQGDGKGITRNFSTCSPSIKTCPDGHCDAVESKDAHICPQDCLRGGSIIGGHEPGERRG
IKAGFGICNCFPEEKKCFCEPEDNQDPLCDELCRTVIAAAVLFSFIVSVLLSTFCIHRYH
KNAHKPPIASAEMTFRRPAQAFPVSYSSSGARRPSLDSMENPVSVDAFKIPEDPKWEFPR
KNLVLGKTLGEGEFGKVVKATAFRLKGKAGYTTVAVKMLKENASPSELRDLLSEFNLLKQ
VNHPQVIKLYGACSQDGPLLLIVEYAKYGSLRGFLRESRKAGPGYVGSGGSRHSSYLDNP
EERALTMGDLISFAWQISRGMQYLAEMKLVHRDLAARNVLVAEGRRMKISDFGLSRDVYE
EDSYVKRSKGRIPVKWMAIESLFDHIYTTQSDVWSFGVLLWEIVTLGGNPYPGIPPERLF
NLLKTGYRMERPDNCSEEMYSLMLQCWKQEPDKRPVFADISKDLDKMMVKSRDYLDLAAS
TPSDSLLYDDGLSEEETPLVDCNNAPLPRTLPSTWIENKLYGMSDPNWPEESPVPLTRAD
GTNTGCPRYANDSVYANWMVSPSAAQLMDAFDS
NT seq 3342 nt   +upstreamnt  +downstreamnt
atggcgaaggcgacggtcggtgccgtggggctgcggttgttgctgctgctgccgctactc
ggcgaagccccgctgggactctacttctcaagggatgcctactgggagaagctgtacgtg
gaccagccggcaggcatgcctctgctctacgtccacgccctgcaggatgtccccggggag
gtgcccagcttccgcctgggccagcacctctatggtgtctaccgcacacggctgcacgag
aatgactggatccgcatccaggaggacacggggcttctctaccttaaccagagcctggac
cacagctcctgggagaagctcagcatccgaaacggcggcttccccctgctcaccgtttac
ctccaagttttcctgtcacctgcgtcccttcgagagagcgagtgccagtggccaggctgt
gcccgagtgtacttctccttcatcaatgcttccttcccggcttgtggagccctcaaaccc
cgggatctctgcttcccgaggcaagccntgtccttccgcattcgggagaataggcctcct
ggaaccttccaccaattccgcctgctgcctgtacagttcctctgccccaacgtcagtgta
gcctacagcctcctgggaggtgagagtcagcccttccgctgcgccgccgacagcctggag
gtgagcacgcgctgggccctggaccgtgagcagcgggagaagtatgagctggtggccgcg
tgcactgtgcgtgtgggcgcacgcgaggaggaggtgatggtgcccttccccgtgacggtg
tacgacgaggacgactgtgcgcccaccttcctcgggggcatcgacactgccagcgcagtg
gtggagttcaagcggaaggagggcactgtggtggccacgctgcgtgtcttcgatgcagat
gtggtgccagcatctggggagctcctgcgccggtacacgaacacactgctctccagggac
acctgggccctccagaccttccgagtagagcacttgcccaacgagaccttggcccaggtc
aacggcagctttgtgcgggccaccatacatgactacaggctggttctcaaccggagcctc
tccatcttggagaaccgggcggtgcagctggccgtgctggtcaacgactcagacttccag
ggccccggagagggagtcctcctcctccacttcaatgtgtccgtgctgcccgtcagcctg
cacctgcccagcgcctactcctttgctgtgagcaggcgggcccaccgctttgcccagatt
gggaaagtctgcgtggaaaactgccaggagttcagtggcatccatgtgcagtacaagctg
cagctctccaacgccaactgcagtgccctgggantagtcacctcggctgaggacaccacg
gggaccctgttcgtgaatgacacggaggcgctgcagcggtccgagtgtgcccagctcgag
tacaaggtggtggctgtcgaccggctgacccgcaggcaaacccaggcctcactgcttgtc
accgtggaggggacatatgtggctgaggagccaggctgccccctgtcctgcgcggtcagc
aagaggcagcccgagtgtgaggagtgtggcggcctgggctctctgaatggcaggtgcgag
tggagacagggagacggcaaaggaatcaccaggaacttctccacctgctcccccagcatc
aagacctgccctgacggccactgtgatgccgtggagagcaaagatgcccacatctgcccc
caggactgcctccggggcggcagcatcatcggtgggcacgagccaggggagcgccggggg
attaaagctggcttcggtatctgcaactgcttccctgaggagaagaagtgcttctgtgag
ccggaagataaccaggacccgctgtgtgatgagctctgccgcacagtcattgcggctgct
gtgctcttctccttcattgtatccgtgctgctatccaccttctgcatccaccgctaccac
aagaacgcccacaagccgcccattgcctcggctgagatgaccttccgccggcctgcccag
gccttcccggtcagctactcctcatctggtgcccgccggccctcgctggactccatggag
aacccggtctctgtggacgccttcaagatcccagaggatccaaagtgggaattccctcgg
aagaacttggttcttggaaaaaccctgggagaaggtgaatttggaaaagtggtcaaggcg
acagccttccggctgaagggaaaagcagggtacacaactgtggccgtgaagatgctgaaa
gagaacgcctccccaagcgagctgcgggacctgctgtcagagttcaacctgctaaagcag
gtcaaccacccgcaagtcatcaagctgtacggggcctgcagccaagatgggccactcctt
ctcatcgtggagtacgccaagtacggctccctgcggggcttcctccgagagagccgcaag
gcggggcctggctatgtgggcagcggaggcagccgccactccagctacctggacaacccc
gaggagcgggccctgaccatgggcgacctcatctcctttgcgtggcagatttcgcggggc
atgcagtacctggctgagatgaagctcgtccatcgagacttggcggccagaaatgtcctg
gtagccgaggggcgcaggatgaagatctcagacttcggtctgtcccgagatgtttatgaa
gaggattcctatgtgaagaggagcaagggtcggatcccggtcaaatggatggccattgag
tcccttttcgatcacatctacaccacccagagtgatgtgtggtcctttggggtcctgctg
tgggagattgtgaccctggggggcaacccctaccctggcattcctccagagcggctcttc
aaccttctgaagacaggctacaggatggagaggccagacaactgcagcgaggagatgtac
agtctgatgctacagtgctggaagcaggaaccggacaagaggccagtgtttgctgacatc
agcaaagacctggataagatgatggttaagagcagagactacttggacctggctgcgtcc
accccatctgactccctgctatatgacgacggcctctcggaggaggagacgcccctggtg
gactgtaataatgctcccctccctcgaacccttccctccacgtggattgaaaacaaactc
tatggcatgtcagacccgaactggcctgaagagagtcctgtaccactcacgagagccgat
ggcactaacactggttgcccgagatatgcaaatgatagtgtatatgctaactggatggtt
tcaccctcagcggcacaattaatggacgcatttgatagttaa

KEGG   Sus scrofa (pig): 100519957
Entry
100519957         CDS       T01009                                 

Gene name
KIF5A
Definition
(RefSeq) kinesin heavy chain isoform X1
  KO
K10396  kinesin family member 5
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04144  Endocytosis
ssc04728  Dopaminergic synapse
ssc05010  Alzheimer disease
ssc05012  Parkinson disease
ssc05014  Amyotrophic lateral sclerosis
ssc05016  Huntington disease
ssc05020  Prion disease
ssc05022  Pathways of neurodegeneration - multiple diseases
ssc05132  Salmonella infection
ssc05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100519957 (KIF5A)
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    100519957 (KIF5A)
 09160 Human Diseases
  09162 Cancer: specific types
   05223 Non-small cell lung cancer
    100519957 (KIF5A)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100519957 (KIF5A)
   05012 Parkinson disease
    100519957 (KIF5A)
   05014 Amyotrophic lateral sclerosis
    100519957 (KIF5A)
   05016 Huntington disease
    100519957 (KIF5A)
   05020 Prion disease
    100519957 (KIF5A)
   05022 Pathways of neurodegeneration - multiple diseases
    100519957 (KIF5A)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100519957 (KIF5A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ssc04131]
    100519957 (KIF5A)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ssc04812]
    100519957 (KIF5A)
   04147 Exosome [BR:ssc04147]
    100519957 (KIF5A)
Membrane trafficking [BR:ssc04131]
 Others
  Actin-binding proteins
   Others
    100519957 (KIF5A)
Cytoskeleton proteins [BR:ssc04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     100519957 (KIF5A)
Exosome [BR:ssc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100519957 (KIF5A)
SSDB
Motif
Pfam: Kinesin Microtub_bd ATG16 BLOC1_2 Spc7
Other DBs
NCBI-GeneID: 100519957
NCBI-ProteinID: XP_020947519
LinkDB
Position
5
AA seq 1039 aa
MAETNNECSIKVLCRFRPLNQAEILRGDKFIPIFQGDDSVVIGGKPYVFDRVFPPNTTQE
QVYHACAMQIVKDVLAGYNGTIFAYGQTSSGKTHTMEGKLHDPQLMGIIPRIARDIFNHI
YSMDENLEFHIKVSYFEIYLDKIRDLLDVTKTNLSVHEDKNRVPFVKGCTERFVSSPEEI
LDVIDEGKSNRHVAVTNMNEHSSRSHSIFLINIKQENMETEQKLSGKLYLVDLAGSEKVS
KTGAEGAVLDEAKNINKSLSALGNVISALAEGTKSYVPYRDSKMTRILQDSLGGNCRTTM
FICCSPSSYNDAETKSTLMFGQRAKTIKNTASVNLELTAEQWKKKYEKEKEKTKAQKETI
AKLEAELSRWRNGENVPETERLAGEDAALGAELCEETPVNDNSSIVVRIAPEERQKYEEE
IRRLYKQLDDKDDEINQQSQLIEKLKQQMLDQEELLVSTRGDNEKVQRELSHLQSENDAA
KDEVKEVLQALEELAMNYDQKSQEVEEKSQQNQLLVDELSQKVATMLSLESELQRLQEVS
GHQRKRIAEVLNGLMKDLSEFSVIVGNGEIKLPVEISGAIEEEFTVARLYISKIKSEVKS
VVKRCRQLENLQVECHRKMEVTGRELSSCQLLISQHEAKIRSLTEYMQSVELKKRHLEES
YDSLSDELAKLQAQETVNEVALKDKEPDTQDADEAKKALELQMESHREAHHRQLARLRDE
INEKQKTIDELKDLNQKLQLELEKLQADYEKLKNEEHEKSTKLQELTFLYERHEQSKQDL
KGLEETVARELQTLHNLRKLFVQDVTTRVKKSAEMEPEDSGGIHSQKQKISFLENNLEQL
TKVHKQVDDWVSKLVRDNADLRCELPKLEKRLRATAERVKALEGALKEAKEGAMKDKRRY
QQEVDRIKEAVRYKSSGKRGHSAQIAKPVRPGHYPASSPTNPYGTRSPECISYTNSLFQN
YQNLYLQAAPSSTSDMYFANSCSSSGATSSGGPLTSYQKVNMDNGNTTDINDNRSDLPCG
YEAEDQAKLFPLHQETAAS
NT seq 3120 nt   +upstreamnt  +downstreamnt
atggcggagaccaacaacgaatgtagcatcaaggtgctctgccgatttcggcccctgaac
caggccgagattctgcggggggacaagttcatccccattttccaaggggacgacagcgtc
gttattggggggaagccgtatgtctttgaccgtgtgttccccccaaacacgactcaggag
caagtttatcatgcatgtgccatgcagattgtcaaagatgtccttgctggctacaatggc
accatttttgcttatggacagacatcctcagggaaaacacatactatggagggaaagctg
catgacccccagctgatggggatcattcctcgaattgcccgagacatcttcaaccacatc
tactccatggacgagaaccttgagttccacatcaaggtgtcttactttgagatttacctg
gacaaaattcgtgaccttctggatgtgaccaagacaaatctgtctgtgcacgaggacaag
aaccgggtgccgtttgtcaagggttgtaccgaacgctttgtgtccagcccagaggagatt
ttagatgtgattgatgaagggaaatcaaatcgtcatgtggctgtcactaacatgaatgaa
cacagctctcgaagccatagcatcttcctcatcaacatcaagcaggagaatatggagact
gagcagaagctcagcgggaagctgtatctcgtggacctggcagggagcgagaaggtcagc
aagactggagctgagggagccgtgctggacgaggccaagaatatcaacaaatcgctgtca
gccctggggaatgtgatctcggcactggcggagggcactaaaagctacgttccatatcgc
gacagcaaaatgacacgaattctccaggactccttgggaggaaactgccgtacaactatg
ttcatctgctgctcaccgtccagctacaacgatgcggagaccaagtccaccctgatgttc
gggcagcgggcaaagaccattaagaacactgcttcagtgaacctggagttgaccgccgag
cagtggaagaagaaatatgagaaggagaaggagaagacaaaggctcagaaagagacgatt
gcaaagctggaggctgagctgagccggtggcgcaatggagagaacgtgcctgagacggag
cgcttggctggggaggatgccgcgctgggcgctgagctctgtgaggagacccccgtgaac
gacaactcatccatcgtggtgcgcatcgcccctgaggagcggcagaagtacgaggaagag
atccgccgcctctacaagcagctggatgacaaggatgatgagatcaaccaacagagccaa
ctcatagagaagctcaagcagcaaatgctggaccaagaagagctgctggtgtccactcga
ggagacaatgagaaggtccagcgggagctgagccacctgcagtcagagaacgatgctgcg
aaggatgaggtgaaggaagtactgcaggcactggaggagctggccatgaactacgaccag
aagtcccaggaggtggaggagaagagccaacagaaccagcttctggtggatgagctgtct
cagaaggtggccaccatgctgtccctggagtctgaattgcagcggctacaggaggtcagt
ggacaccaacgaaaacgaattgctgaggtgctgaacgggctgatgaaggacctgagtgag
ttcagcgtcatcgtgggcaacggggagattaagctgccagtggagatcagtggggccatc
gaggaggagttcactgtggcccgactctatatcagcaaaatcaaatccgaagtcaagtct
gtggtcaaacggtgccggcagctagagaacctccaggtcgagtgtcaccgcaagatggaa
gtgactgggcgggagctctcatcctgccagctccttatctcccagcacgaggccaagatc
cgctctctcacggaatacatgcagagtgtggagctcaagaagcggcacctggaagagtcc
tatgactccctgagtgacgagctggccaagctccaggcccaggagactgtgaatgaagtg
gccctgaaggacaaggagccagacacacaggacgcagatgaggcgaagaaggccctggag
ctgcagatggagagccaccgggaggcccatcaccggcagctggcccggctccgggacgag
atcaatgagaagcagaagaccatcgatgagctcaaagacctaaatcagaagctccagtta
gagctggagaagcttcaggctgactatgagaagctgaagaatgaagaacacgagaaaagt
accaaactccaggagctgacatttctgtacgagcgacacgagcagtccaaacaggacctc
aagggtctggaggagacagttgcccgggaactccagaccctccacaaccttcgcaagctg
ttcgttcaagacgtcacgactcgagtcaagaaaagtgcagaaatggagcccgaggacagt
ggggggattcactcccaaaaacagaagatttcctttcttgagaacaacctggaacagctt
acaaaggttcacaaacaggtggatgactgggtttcaaagctggtacgtgacaatgcagat
ctgcgttgtgagcttcctaaattggaaaaacgacttagggctacggctgagagagttaag
gccctggagggtgcactgaaggaggccaaggagggcgccatgaaggacaagcgccggtac
cagcaggaggtggaccgcatcaaggaggccgttcggtacaagagctccggcaagcggggt
cattctgcccagattgccaaacctgtccggcctggccactacccagcatcttcacccacc
aacccctacggcacccggagccctgagtgcatcagttacactaacagcctcttccagaac
taccagaatctgtacctgcaggccgcacccagctccacctcagatatgtactttgcaaac
tcctgtagcagcagtggggccacatcttctggcggccccttgacttcctaccagaaggtc
aacatggacaatggaaacaccacagatattaatgacaataggagtgacctgccatgcggc
tatgaggctgaggaccaggccaagctgttccctctccaccaagagacggcagccagctaa

KEGG   Sus scrofa (pig): 100622102
Entry
100622102         CDS       T01009                                 

Gene name
KIF5C
Definition
(RefSeq) kinesin heavy chain
  KO
K10396  kinesin family member 5
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04144  Endocytosis
ssc04728  Dopaminergic synapse
ssc05010  Alzheimer disease
ssc05012  Parkinson disease
ssc05014  Amyotrophic lateral sclerosis
ssc05016  Huntington disease
ssc05020  Prion disease
ssc05022  Pathways of neurodegeneration - multiple diseases
ssc05132  Salmonella infection
ssc05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100622102 (KIF5C)
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    100622102 (KIF5C)
 09160 Human Diseases
  09162 Cancer: specific types
   05223 Non-small cell lung cancer
    100622102 (KIF5C)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100622102 (KIF5C)
   05012 Parkinson disease
    100622102 (KIF5C)
   05014 Amyotrophic lateral sclerosis
    100622102 (KIF5C)
   05016 Huntington disease
    100622102 (KIF5C)
   05020 Prion disease
    100622102 (KIF5C)
   05022 Pathways of neurodegeneration - multiple diseases
    100622102 (KIF5C)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100622102 (KIF5C)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ssc04131]
    100622102 (KIF5C)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ssc04812]
    100622102 (KIF5C)
   04147 Exosome [BR:ssc04147]
    100622102 (KIF5C)
Membrane trafficking [BR:ssc04131]
 Others
  Actin-binding proteins
   Others
    100622102 (KIF5C)
Cytoskeleton proteins [BR:ssc04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     100622102 (KIF5C)
Exosome [BR:ssc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100622102 (KIF5C)
SSDB
Motif
Pfam: Kinesin Microtub_bd
Other DBs
NCBI-GeneID: 100622102
NCBI-ProteinID: XP_003359464
Ensembl: ENSSSCG00000022919
UniProt: A0A480PZV2 A0A4X1THT2
LinkDB
Position
15
AA seq 957 aa
MADPAECSIKVMCRFRPLNEAEILRGDKFIPKFKGDETVVIGQGKPYVFDRVLPPSTTQE
QVYNACAKQIVKDVLEGYNGTIFAYGQTSSGKTHTMEGKLHDPQLMGIIPRIAHDIFDHI
YSMDENLEFHIKVSYFEIYLDKIRDLLDVSKTNLAVHEDKNRVPYVKGCTERFVSSPEEV
MDVIDEGKANRHVAVTNMNEHSSRSHSIFLINIKQENVETEKKLSGKLYLVDLAGSEKVS
KTGAEGAVLDEAKNINKSLSALGNVISALAEGTKTHVPYRDSKMTRILQDSLGGNCRTTI
VICCSPSVFNEAETKSTLMFGQRAKTIKNTVSVNLELTAEEWKKKYEKEKEKNKTLKNVI
QHLEMELNRWRNGEAVPEDEQISAKDQKTLEPCDNTPIIDNIAPVVAGITAEEKEKYDEE
ISSLYRQLDDKDDEINQQSQLAEKLKQQMLDQDELLASTRRDYEKIQEELTRLQIENEAA
KDEVKEVLQALEELAVNYDQKSQEVEDKTRANEQLTDELAQKTTTLTTTQRELSQLQELS
NHQKKRATEILNLLLKDLGEIGGIIGTNDVKTLADVNGVIEEEFTMARLYISKMKSEVKS
LVNRSKQLESAQMDSNRKMNASERELAACQLLISQHEAKIKSLTDYMQNMEQKRRQLEES
QDSLSEELAKLRAQEKMHEVSFQDKEKEHLTRLQDAEEMKKALEQQMESHREAHQKQLSR
LRDEIEEKQKIIDEIRDLNQKLQLEQEKLSSDYNKLKIEDQEREMKLEKLLLLNDKREQA
REDLKGLEETVSRELQTLHNLRKLFVQDLTARVKKSVELDSDDGGGSAAQKQKISFLENN
LEQLTKVHKQLVRDNADLRCELPKLEKRLRATAERVKALESALKEAKENAMRDRKRYQQE
VDRIKEAVRAKNMARRAHSAQIAKPIRPGHYPASSPTAVHAIRGGGGGSSNPTHHQK
NT seq 2874 nt   +upstreamnt  +downstreamnt
atggcggatccagccgaatgcagcatcaaagtgatgtgccggttccggccacttaacgaa
gcagagatccttcgcggggacaaattcatccccaaatttaaaggcgatgagaccgtggtg
atcgggcaaggaaagccgtatgtcttcgacagagtgctgcctcccagcacgacccaagag
caggtttacaatgcatgtgcaaagcaaattgtcaaagatgtccttgaaggttataatggg
acaatttttgcatatggacagacttcatcaggaaaaacacacaccatggaggggaagctc
cacgaccctcagctcatgggcatcattccaaggatcgcacatgacatctttgaccatatc
tattccatggatgaaaatctggagttccacatcaaggtttcctactttgaaatctacttg
gacaaaatcagggacttactggatgtatccaagacaaacttggctgttcatgaagataaa
aacagagtcccatatgtaaaggggtgcactgagcggtttgtgtcaagccccgaggaagtc
atggatgtgatagatgaaggcaaagcaaaccgccatgtggctgtaacaaacatgaatgaa
cacagctctagaagtcacagtatcttcctgattaatattaaacaagagaatgtagagact
gaaaaaaaactcagtggaaagctgtatctggttgatttggctgggagcgaaaaggtcagc
aaaactggtgccgagggagctgttctcgacgaagcgaaaaatatcaataagtctttgtct
gctctgggaaacgtgatctctgccttggcagaagggacaaaaacacacgtgccataccgg
gacagcaaaatgactcgaattcttcaggactctctgggagggaactgtagaaccaccatt
gtgatttgttgttctccctcagtcttcaatgaagctgaaaccaagtcaacactaatgttt
ggacaaagggctaagaccatcaaaaatacagtttctgtgaacctggagctgacagcagaa
gaatggaagaagaaatacgaaaaagagaaagagaaaaacaagactttgaagaatgttatc
cagcatctggagatggagctgaacagatggagaaatggagaagctgtacctgaggatgag
cagatcagtgccaaggaccagaagaccctggagccctgtgataacacccccatcatagac
aacattgcgcctgtggtcgccggcatcactgcagaggagaaggagaagtatgatgaggag
atctccagtctctaccgacaactggatgataaggatgatgaaattaaccagcagagccaa
ctggctgaaaagctaaagcaacagatgttggatcaagatgagcttctagcttccacaaga
agagactatgagaagattcaggaggagctgacacgtctccagattgaaaacgaggcagcc
aaagacgaggtgaaggaagttctccaggctctggaggagctggctgtcaattatgaccag
aagtcacaggaagtggaggacaagaccagggccaatgagcagctgacagatgagctggcc
cagaaaacgactacactgacaaccacacagcgagagctaagtcagctgcaagagcttagc
aatcaccagaagaagagggctactgaaatcctgaatttgctgttgaaggatctgggggag
ataggaggaattattggcaccaatgatgtaaagactttggcagatgtgaatggagtcatt
gaggaggaattcaccatggcccgcctgtacatcagcaagatgaagtccgaggtcaagtcc
ctggtgaaccgcagcaaacagctggagagtgctcagatggactccaataggaagatgaac
gccagtgagcgggagctggctgcctgccagctgctcatctcccagcatgaagccaagatc
aaatccctgacagactacatgcagaacatggagcagaagcgaaggcagctggaagagtcc
caagactcgctcagtgaagagctggccaaactccgagcccaagaaaaaatgcatgaagtc
agcttccaggataaggagaaggaacatctgacccggctgcaggatgctgaggaaatgaag
aaggcactggaacaacagatggagagccaccgggaagctcatcagaagcagctgtccaga
ctccgagatgagatcgaggagaagcagaaaatcatcgatgagattcgggatttgaatcag
aaactgcaactggaacaggagaagctcagttctgattataataagctgaaaatagaggac
caagagagagagatgaaactggaaaagctcttattgctcaatgataaaagggaacaagcc
agagaggacctcaaagggctagaagagacagtgtctcgagagctacagactctacacaat
ctccgtaaactcttcgtccaggatctgaccgcccgtgttaaaaaaagcgtggagctggac
agtgacgatggaggaggaagtgccgcccagaagcagaaaatttccttcctggagaataac
ctagagcagctcactaaagttcacaaacagctcgtccgggacaacgcagacctgcgctgt
gagctgcccaaactggagaagcgcctgcgcgccacagcggagcgagttaaggcgctggag
agtgcgctgaaagaggccaaggagaatgccatgcgggaccgcaagcgctaccagcaggag
gtggaccgtatcaaggaggccgtgcgagccaagaacatggccaggagggcccactcggcc
cagattgccaagcccatccgccctggacactacccggcatcgtctccaacggctgtccat
gccatccgagggggaggaggcggctcttcaaaccccactcaccaccagaaataa

KEGG   Sus scrofa (pig): 595132
Entry
595132            CDS       T01009                                 

Gene name
KIF5B
Definition
(RefSeq) kinesin-1 heavy chain
  KO
K10396  kinesin family member 5
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04144  Endocytosis
ssc04728  Dopaminergic synapse
ssc05010  Alzheimer disease
ssc05012  Parkinson disease
ssc05014  Amyotrophic lateral sclerosis
ssc05016  Huntington disease
ssc05020  Prion disease
ssc05022  Pathways of neurodegeneration - multiple diseases
ssc05132  Salmonella infection
ssc05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    595132 (KIF5B)
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    595132 (KIF5B)
 09160 Human Diseases
  09162 Cancer: specific types
   05223 Non-small cell lung cancer
    595132 (KIF5B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    595132 (KIF5B)
   05012 Parkinson disease
    595132 (KIF5B)
   05014 Amyotrophic lateral sclerosis
    595132 (KIF5B)
   05016 Huntington disease
    595132 (KIF5B)
   05020 Prion disease
    595132 (KIF5B)
   05022 Pathways of neurodegeneration - multiple diseases
    595132 (KIF5B)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    595132 (KIF5B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ssc04131]
    595132 (KIF5B)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ssc04812]
    595132 (KIF5B)
   04147 Exosome [BR:ssc04147]
    595132 (KIF5B)
Membrane trafficking [BR:ssc04131]
 Others
  Actin-binding proteins
   Others
    595132 (KIF5B)
Cytoskeleton proteins [BR:ssc04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     595132 (KIF5B)
Exosome [BR:ssc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   595132 (KIF5B)
SSDB
Motif
Pfam: Kinesin Microtub_bd Crescentin
Other DBs
NCBI-GeneID: 595132
NCBI-ProteinID: XP_020920464
Ensembl: ENSSSCG00000011027
LinkDB
Position
10
AA seq 963 aa
MADPAECNIKVMCRFRPLNESEVNRGDKYIAKFQGEDTVMIASKPYAFDRVFQSSTSQEQ
VYNDCAKKIVKDVLEGYNGTIFAYGQTSSGKTHTMEGKLHDPEGMGIIPRIVQDIFNYIY
SMDENLEFHIKVSYFEIYLDKIRDLLDVSKTNLSVHEDKNRVPYVKGCTERFVCSPDEVM
DTIDEGKSNRHVAVTNMNEHSSRSHSIFLINVKQENTQTEQKLSGKLYLVDLAGSEKVSK
TGAEGAVLDEAKNINKSLSALGNVISALAEGSTYVPYRDSKMTRILQDSLGGNCRTTIVI
CCSPSSYNESETKSTLLFGQRAKTIKNTVCVNVELTAEQWKKKYEREKEKNKTLRNTIQW
LENELNRWRNGETVPIDEQFDKEKANLEAFAVDKDITISNDKPAATIGVTGNFTDAERRK
CEEEIAKLYKQLDDKDEEINQQSQLVEKLKTQMLDQEELLASTRRDQDNMQAELNRLQAE
NDASKEEVKEVLQALEELAVNYDQKSQEVEDKTKEYELLSDELNQKSATLASIDAELQKL
KEMTNHQKKRAAEMMASLLKDLAEIGIAVGNNDVKQPEGTGMIDEEFTVARLYISKMKSE
VKTMVKRCKQLESTQTESNKKMEENEKELAACQLRISQHEAKIKSLTEYLQNVEQKKRQL
EESVDSLNEELVQLRAQEKVHEMEKEHLNKVQTANEVKQAVEQQIQSHRETHQKQISSLR
DEVEAKEKLITDLQDQNQKMMLEQERLRVEHEKLKATDQEKSRKLHELTVMQDRREQARQ
DLKGLEETVAKELQTLHNLRKLFVQDLATRVKKSAEIDSDDTGGSAAQKQKISFLENNLE
QLTKVHKQLVRDNADLRCELPKLEKRLRATAERVKALESALKEAKENASRDRKRYQQEVD
RIKEAVRSKNMARRGHSAQIAKPIRPGQHPAASPTHPSAIRGGGAFVQNSQPVAVRGGGG
KQV
NT seq 2892 nt   +upstreamnt  +downstreamnt
atggcggacccggccgaatgcaacatcaaagtgatgtgtcgcttcagacctctgaacgag
tccgaggtgaaccgcggcgataagtacatcgccaagtttcagggagaagacacggtcatg
atcgcgtccaagccttacgcatttgaccgggtgttccagtcaagcacatctcaagagcaa
gtgtacaatgactgtgcaaagaagattgttaaagatgtacttgaaggatacaatggaaca
atatttgcatacggacagacatcttccgggaagacacacacaatggagggtaaacttcat
gatccagaaggcatgggaattattccaagaatagtgcaagatatttttaattatatttat
tccatggatgaaaacttggaatttcatattaaggtttcatattttgaaatttatttggat
aagataagggacctattagatgtttcaaagaccaatctttcagttcatgaagataaaaat
cgagttccctatgtgaaggggtgcacagagcgttttgtatgtagtccagatgaagttatg
gataccatcgatgaaggaaaatccaacagacacgtagcagttacaaatatgaatgaacat
agctctaggagtcacagtatatttcttattaatgtgaaacaagagaacacacaaacagaa
caaaagctgagtggaaaactttatctggtcgatttagctggtagtgaaaaggttagtaaa
actggagctgaaggtgctgtgctggatgaagctaagaatatcaacaagtccctttctgct
ctcggcaatgtcatttctgctctggctgagggtagtacctatgttccatatcgagatagt
aaaatgacaagaatccttcaagattcgttaggtgggaactgtagaaccactattgtaatt
tgctgctctccatcatcatacaatgaatctgaaacgaaatctacactcctgtttggtcag
agggccaaaacaattaagaacacagtttgtgtcaatgtagagttaactgcagaacagtgg
aaaaagaagtatgaaagagaaaaagaaaaaaacaagaccttgcggaacaccattcagtgg
cttgaaaatgaactcaaccgatggcgtaatggagagacagtgcctattgatgaacagttt
gacaaagagaaagccaacttggaagcatttgcggtggataaggatattactattagcaat
gataagccagcagccactattggagttactggaaattttactgatgctgaaagaagaaag
tgtgaagaagaaattgctaaattgtacaaacagcttgatgacaaggatgaagaaattaat
caacagagtcaattggtagagaaactgaagacccaaatgttggatcaggaggagcttctg
gcatctaccagaagggatcaagataatatgcaggctgagctgaatcgccttcaggcagaa
aacgatgcctctaaagaagaagtaaaagaagttttacaagccttagaagaacttgctgtc
aactatgatcagaagtctcaggaagttgaagacaaaactaaggaatatgagttacttagt
gatgaactgaatcagaaatcggcaactttagcaagtatagatgctgagcttcagaaactt
aaggaaatgaccaaccaccagaaaaaacgagcagctgagatgatggcatctttactaaaa
gacctagcagaaataggaattgctgtaggaaataatgacgtcaagcaacctgagggaact
ggcatgatagatgaagagttcactgttgcacggctctacattagcaaaatgaaatcagaa
gttaaaacaatggtgaaacgttgcaaacagttagaaagcacacaaactgagagcaataaa
aaaatggaagaaaatgaaaaggagttagcagcatgccagcttcggatctctcaacatgaa
gccaaaatcaaatcattgactgaataccttcaaaatgtggagcaaaagaaaagacaactg
gaggagtctgttgattctctcaatgaggagctagtccagcttcgagcacaagagaaagta
catgaaatggaaaaggagcacttaaataaggttcagactgcaaatgaagttaagcaagct
gttgaacagcagatccaaagccacagagagactcatcagaaacaaattagtagtttgaga
gatgaagtcgaggcaaaagaaaaacttattactgatcttcaagaccaaaaccagaaaatg
atgctagaacaggaacgtctgagagtagaacatgagaagttgaaagctacagatcaggaa
aagagcaggaaattacatgaacttacggttatgcaagatagacgagaacaagcaagacaa
gacttgaagggtttggaagagacagtggcaaaggaacttcagactttacacaacctacgg
aagctctttgttcaagacctggccaccagggttaaaaagagtgccgaaatcgattctgat
gacactggaggtagtgctgctcaaaagcaaaaaatctcctttcttgaaaataatcttgag
caactcactaaagtgcacaaacagttggtacgtgataatgcagatcttcgctgtgagctt
cctaagttggaaaagcgactcagagctacagctgagagggtgaaagctttggagtctgca
ctgaaagaagccaaagaaaatgcatctcgtgatcgcaaacgctatcagcaggaagtagat
cgtataaaggaagcagtcagatcaaagaatatggccagaagaggacattctgcacaaatt
gctaaacctattcgtcctgggcaacatcccgcagcttctccgactcatccaagtgcaatt
cgtggaggaggtgcatttgttcagaacagccagccagtggcagtacgaggcgggggaggc
aagcaggtgtaa

DBGET integrated database retrieval system