KEGG   Sus scrofa (pig): 100155148
Entry
100155148         CDS       T01009                                 

Gene name
MIPEP
Definition
(RefSeq) mitochondrial intermediate peptidase
  KO
K01410  mitochondrial intermediate peptidase [EC:3.4.24.59]
Organism
ssc  Sus scrofa (pig)
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ssc01002]
    100155148 (MIPEP)
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:ssc03029]
    100155148 (MIPEP)
Enzymes [BR:ssc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.59  mitochondrial intermediate peptidase
     100155148 (MIPEP)
Peptidases and inhibitors [BR:ssc01002]
 Metallo peptidases
  Family M3
   100155148 (MIPEP)
Mitochondrial biogenesis [BR:ssc03029]
 Mitochondrial protein import machinery
  Matrix
   Other matrix factors
    100155148 (MIPEP)
SSDB
Motif
Pfam: Peptidase_M3 Peptidase_M91 DUF3126
Other DBs
NCBI-GeneID: 100155148
NCBI-ProteinID: XP_020921130
LinkDB
Position
11
AA seq 700 aa
MRGAMLCARRLGGLRARLGARQVSTSWSPVGAAFNVRPQGRRLDLFGERQGLFGVPTLRA
PEGFRVAQERALRRTEQLVARACSLPPGPQTVLLFDELSDALCRVADLADFVRIAHPEAA
FREAAEEACRSIGTAVEKLNTNVELYQSLQKLLADERLANSLDPETRRVAELFLFDFEIS
GIHLDNDKRRRAVDLNVKILDLSSTFLMGTNLPVKAEKHLLPERVWHHFEVAGDHVVVDG
LRAEAPDDLVREAAYKIFLYPNAGQLKCLEELLSNRDLLAKLVGYESFSHRALQGTMARS
PETVMQFLEKLSDKLSERTMKDFEMMRGMKMKLNPQNSELMPWDPPYYSSLIRAERSSVE
PGAYGPFFSLGACMDGLDVLLGRLLGVSLRVQQPAPGEVWAQDVRKLAVVHESEGLLGYI
YCDFFQRADKPHQDCHFTIRGGRVREDGSYQLPVVVLMLNLPQPSRDSPTLLTPGMMENL
FHEMGHAMHSMLGRTRYQHVTGTRCPTDFAEVPSILMEYFAADYRVVQQFARHYQTGQSL
PRSMVSRLCESKKVCAAADMQLQVFYAALDQLYHGPHPRGRCTTDVLRATQERFYGLPYV
PGTAWQLRFSHLVGYGAKYYSYLMSRAVASMVWRECFLQDPFNRAAGERYRREMLAHGGG
KEPLLMVEGMLQKRPSIDDFVNALVCDLDLDAESFLADSE
NT seq 2103 nt   +upstreamnt  +downstreamnt
atgcggggcgcgatgctgtgcgcacgacgtctgggcggcctccgggcccggctcggggcc
cggcaggtcagcaccagctggtccccggtgggcgccgcctttaatgtccggccccagggc
cgtcgcctggacctgttcggcgagcgccagggcctcttcggcgtccccacgctcagggcc
ccggagggcttccgcgtggcccaggagagggccctgaggaggacggagcagctggtggcg
cgcgcctgctccctgccgcccgggccgcagaccgtgctcctcttcgacgagctctcggac
gccttgtgcagggtggccgacttggccgactttgtgagaatcgctcaccccgaggcggcg
ttcagggaggcggcggaggaggcctgtcggagcatcggcaccgccgtggagaagttaaac
acaaatgtggaattatatcaaagtctacagaagttactggctgatgaaaggctggcgaac
tccctcgatccggaaaccaggcgagtggccgaactgttcctgtttgattttgaaatcagt
ggaatccatctagacaacgacaagcgcaggagagccgtggacctgaacgtgaagatcctg
gatctgagcagcacgtttctcatggggaccaacctgcccgtcaaggctgagaagcacctc
ttgccggagcgggtctggcaccacttcgaggtggctggggaccacgtcgtggtcgacggt
ctgcgggcggaggcgccggatgacttggtgcgagaagccgcttacaaaatttttctttat
cccaatgctggtcaattgaaatgtctagaagaattgctcagcaacagagatctcctggcc
aagctggtggggtacgagagcttttcccacagggctctccaggggacgatggccagaagc
ccagagacggtcatgcagttccttgagaaactctctgacaaactttctgaaagaaccatg
aaagattttgagatgatgcgagggatgaaaatgaaactaaatcctcaaaattctgagctg
atgccttgggatccaccctactacagcagcctgattcgagcagagaggtccagcgtggag
cccggcgcctacggccccttcttctcgctgggcgcctgcatggacggcctggacgtgctg
ctcggccggctgctgggggtctcgctccgtgtgcagcagcctgcgcccggcgaggtgtgg
gcccaggacgtgcgcaaactggctgtggtccatgagtctgaagggctgctgggatacatc
tactgtgatttttttcagcgagcagacaaaccacatcaggactgtcacttcaccatccga
gggggccgcgtgagggaagacggcagctatcagctccccgttgtcgtcctgatgctgaat
ctcccccagccctcgagggattctccgacgctgctcacgcctggaatgatggaaaacctc
ttccacgagatgggacacgccatgcattcgatgctgggccggactcgctaccagcacgtc
accgggaccaggtgccccacggacttcgccgaggtcccgtccatcctgatggagtacttc
gccgccgactaccgcgtggtgcagcagttcgcccgccactaccagacgggccagtcactg
cccagaagcatggtgtcccgactctgcgagtctaaaaaggtctgcgctgcggccgacatg
cagctccaggtcttctacgcggctctggatcagctctaccacggcccgcacccccggggg
cggtgcaccacggacgtcctcagagccacgcaggagaggttctacggcctgccctacgtc
cccggcacggcctggcagctgcggttcagccacctcgtgggctacggtgccaagtactac
tcatacctgatgtcgcgggcggtggcctccatggtctggagagagtgtttcctacaggat
cctttcaacagggcggcgggggagcgctaccggcgggagatgctggcgcacggcgggggc
aaggagcccctgctcatggtggaaggtatgcttcagaagcgcccttccatcgacgacttc
gtaaacgccctcgtgtgcgacttggatctggacgcggagagcttcctcgcggactcggag
tga

DBGET integrated database retrieval system