KEGG   Sus scrofa (pig): 100155304
Entry
100155304         CDS       T01009                                 

Gene name
SMAD2
Definition
(RefSeq) mothers against decapentaplegic homolog 2
  KO
K04500  mothers against decapentaplegic homolog 2
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04110  Cell cycle
ssc04144  Endocytosis
ssc04218  Cellular senescence
ssc04350  TGF-beta signaling pathway
ssc04371  Apelin signaling pathway
ssc04390  Hippo signaling pathway
ssc04550  Signaling pathways regulating pluripotency of stem cells
ssc04659  Th17 cell differentiation
ssc04926  Relaxin signaling pathway
ssc04933  AGE-RAGE signaling pathway in diabetic complications
ssc05142  Chagas disease
ssc05166  Human T-cell leukemia virus 1 infection
ssc05200  Pathways in cancer
ssc05205  Proteoglycans in cancer
ssc05210  Colorectal cancer
ssc05212  Pancreatic cancer
ssc05225  Hepatocellular carcinoma
ssc05226  Gastric cancer
ssc05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    100155304 (SMAD2)
   04390 Hippo signaling pathway
    100155304 (SMAD2)
   04371 Apelin signaling pathway
    100155304 (SMAD2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100155304 (SMAD2)
  09143 Cell growth and death
   04110 Cell cycle
    100155304 (SMAD2)
   04218 Cellular senescence
    100155304 (SMAD2)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100155304 (SMAD2)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    100155304 (SMAD2)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    100155304 (SMAD2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100155304 (SMAD2)
   05205 Proteoglycans in cancer
    100155304 (SMAD2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100155304 (SMAD2)
   05212 Pancreatic cancer
    100155304 (SMAD2)
   05225 Hepatocellular carcinoma
    100155304 (SMAD2)
   05226 Gastric cancer
    100155304 (SMAD2)
  09163 Immune disease
   05321 Inflammatory bowel disease
    100155304 (SMAD2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100155304 (SMAD2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100155304 (SMAD2)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    100155304 (SMAD2)
SSDB
Motif
Pfam: MH2 MH1 IRF-3
Other DBs
NCBI-GeneID: 100155304
NCBI-ProteinID: NP_001243077
Ensembl: ENSSSCG00000004505
UniProt: G9BWQ0 A0A4X1UN54
LinkDB
Position
1
AA seq 437 aa
MSSILPFTPPVVKRLLGWKKSAGGSGGAGGGEQNGQEEKWCEKAVKSLVKKLKKTGRLDE
LEKAITTQNCNTKCVTIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELKAIENCE
YAFNLKKDEVCVNPYHYQRVETPVLPPVLVPRHTEILTELPPLDDYTHSIPENTNFPAGI
EPQSNYIPETPPPGYISEDGETSDQQLNQSMDTGSPAELSPTTLSPVNHSLDLQPVTYSE
PAFWCSIAYYELNQRVGETFHASQPSLTVDGFTDPSNSERFCLGLLSNVNRNATVEMTRR
HIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEF
AALLAQSVNQGFEAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLD
KVLTQMGSPSVRCSSMS
NT seq 1314 nt   +upstreamnt  +downstreamnt
atgtcgtccatcttgccattcactccgccagttgtgaagagactgctgggatggaagaag
tcagctggtggatctggaggagcaggtggaggagagcagaatggacaggaagagaagtgg
tgtgagaaagcagttaaaagtttggtgaagaagctaaagaaaacaggacgattagatgag
cttgagaaagccatcaccactcaaaattgtaatactaaatgtgttaccataccaaggtcc
cttgatggtcgtcttcaggtatctcatcgaaaaggactgccacacgtaatctattgtcga
ttatggcgctggcctgatcttcacagtcatcatgaactcaaagcaattgaaaactgcgaa
tatgcttttaatcttaaaaaggatgaagtatgtgtaaacccttaccactaccagagagtt
gagacaccagttttgcctccagtattagtgccacggcatactgagatcttaacagaacta
ccacctctggatgattatacccactccattccagaaaacactaatttcccagcgggaatt
gagccacagagtaattatatcccagaaacgccacctcctggatatatcagtgaagatgga
gaaacgagtgatcaacagttgaaccaaagtatggacacaggatcgccagcagaactatcg
cctactactctttcccctgttaatcatagtttggatttgcagccagttacttactcagaa
cctgcattttggtgttcaatagcatattatgaattaaaccagagggttggggagaccttc
cacgcatcacagccctcgctcaccgtagatggcttcacagatccgtccaattcagagagg
ttctgcctaggtttactctccaacgtcaacagaaatgctacagtagaaatgacaagaaga
catataggaagaggagtgcgcttatattacataggcggtgaagtttttgctgagtgccta
agtgacagtgcaatctttgtgcagagccccaactgtaaccagaggtacggctggcaccct
gcaacagtgtgtaaaatcccaccaggctgtaatctgaagatcttcaataaccaggaattt
gctgctcttctggctcagtccgttaatcagggttttgaagccgtgtatcagctaactaga
atgtgcaccataagaatgagttttgtgaaaggctggggagcagaataccgaaggcagaca
gtaacaagcactccttgctggattgaacttcatctgaatggacctctacagtggttggac
aaagtattaactcagatgggatccccttcagtgcgttgctcaagcatgtcataa

KEGG   Sus scrofa (pig): 397260
Entry
397260            CDS       T01009                                 

Gene name
SMAD3
Definition
(RefSeq) mothers against decapentaplegic homolog 3
  KO
K23605  mothers against decapentaplegic homolog 3
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04068  FoxO signaling pathway
ssc04110  Cell cycle
ssc04144  Endocytosis
ssc04218  Cellular senescence
ssc04310  Wnt signaling pathway
ssc04350  TGF-beta signaling pathway
ssc04371  Apelin signaling pathway
ssc04390  Hippo signaling pathway
ssc04520  Adherens junction
ssc04550  Signaling pathways regulating pluripotency of stem cells
ssc04659  Th17 cell differentiation
ssc04933  AGE-RAGE signaling pathway in diabetic complications
ssc05161  Hepatitis B
ssc05166  Human T-cell leukemia virus 1 infection
ssc05200  Pathways in cancer
ssc05210  Colorectal cancer
ssc05212  Pancreatic cancer
ssc05220  Chronic myeloid leukemia
ssc05225  Hepatocellular carcinoma
ssc05226  Gastric cancer
ssc05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    397260 (SMAD3)
   04350 TGF-beta signaling pathway
    397260 (SMAD3)
   04390 Hippo signaling pathway
    397260 (SMAD3)
   04371 Apelin signaling pathway
    397260 (SMAD3)
   04068 FoxO signaling pathway
    397260 (SMAD3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    397260 (SMAD3)
  09143 Cell growth and death
   04110 Cell cycle
    397260 (SMAD3)
   04218 Cellular senescence
    397260 (SMAD3)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    397260 (SMAD3)
   04550 Signaling pathways regulating pluripotency of stem cells
    397260 (SMAD3)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    397260 (SMAD3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    397260 (SMAD3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    397260 (SMAD3)
   05212 Pancreatic cancer
    397260 (SMAD3)
   05225 Hepatocellular carcinoma
    397260 (SMAD3)
   05226 Gastric cancer
    397260 (SMAD3)
   05220 Chronic myeloid leukemia
    397260 (SMAD3)
  09163 Immune disease
   05321 Inflammatory bowel disease
    397260 (SMAD3)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    397260 (SMAD3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    397260 (SMAD3)
   05161 Hepatitis B
    397260 (SMAD3)
SSDB
Motif
Pfam: MH2 MH1 IRF-3
Other DBs
NCBI-GeneID: 397260
NCBI-ProteinID: NP_999302
Ensembl: ENSSSCG00000004952
UniProt: P84024
LinkDB
Position
1
AA seq 425 aa
MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNV
NTKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELCEFAFNMKKDEV
CVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETP
PPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDLQPVTYCEPAFWCSISYYEL
NQRVGETFHASQPSMTVDGFTDPSNSERFCLGLLSNVNRNAAVELTRRHIGRGVRLYYIG
GEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGF
EAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSIR
CSSVS
NT seq 1278 nt   +upstreamnt  +downstreamnt
atgtcgtccatcctgcccttcacgcccccgatcgtgaaacgcctgctgggctggaagaag
ggtgagcagaacgggcaggaggagaagtggtgcgagaaggcggtcaagagtttggtcaag
aagctcaagaagacggggcagctggacgaactggagaaggccatcaccacgcagaacgtc
aacaccaagtgcatcaccatccccaggtccctggatggccggctgcaggtgtcccaccgg
aaggggctcccccatgtcatctactgccgcctgtggcgatggcctgaccttcacagccac
catgagctgcgggccatggagctgtgtgagttcgccttcaacatgaagaaggacgaggtc
tgcgtgaatccctaccactaccagagggtggagaccccagttctacctcctgtgttggtg
ccacgccacacagagatcccggccgagttccccccgctggacgactacagccattccatc
cctgaaaacactaacttccccgcgggcatcgagccccagagcaatattccagaaacccca
cccccgggctacctgagtgaagatggagagaccagcgaccaccagatgaaccacagcatg
gacgcaggttctccaaacctctccccgaatccgatgtccccagcacacaataacttggac
ctgcagcccgtcacctactgcgagccggccttctggtgctccatctcctactacgagctc
aaccagcgcgtcggggagacattccacgcctcgcaaccgtccatgaccgtggacggcttc
accgacccctccaactcggagcgcttctgcctggggctgctctccaatgtcaacaggaat
gcggctgtggagctgacacggaggcacatcgggcgaggcgtgcggctgtactacattgga
ggggaggtcttcgcagagtgcctcagtgacagcgccatctttgtccagtcacccaactgt
aaccagcgctatggctggcacccagccaccgtctgcaagatcccaccaggatgcaacctg
aagatcttcaacaaccaggagtttgccgccctcctggctcagtctgtcaaccagggcttt
gaggccgtgtaccagctgacacggatgtgcaccatccgcatgagcttcgtcaagggctgg
ggcgccgagtacaggagacagactgtgaccagcaccccctgctggattgagctgcacctg
aatgggccattgcagtggcttgacaaggtcctcacccagatgggctccccaagcatccgc
tgttccagtgtgtcttag

DBGET integrated database retrieval system